KEGG   Homo sapiens (human): 35Help
Entry
35                CDS       T01001                                 

Gene name
ACADS, ACAD3, SCAD
Definition
(RefSeq) acyl-CoA dehydrogenase short chain
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00410  beta-Alanine metabolism
hsa00640  Propanoate metabolism
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01212  Fatty acid metabolism
Network
nt06020  beta-Oxidation in mitochondria
nt06024  Valine, leucine and isoleucine degradation
  Element
N00766  HADHB deficiency in beta-oxidation
N00767  HADH deficiency in beta-oxidation
N00770  ACADS deficiency in beta-oxidation
N00775  HADHA deficiency in beta-oxidation
N00804  beta-Oxidation
N00852  Valine degradation
N00853  ALDH6A1 deficiency in valine degradation
N00854  HIBCH deficiency in valine degradation
N00856  Isoleucine degradation
N00857  HSD17B10 deficiency in isoleucine degradation
Disease
H00525  Disorders of mitochondrial fatty-acid oxidation
H01980  SCAD deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    35 (ACADS)
   00650 Butanoate metabolism
    35 (ACADS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    35 (ACADS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    35 (ACADS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    35 (ACADS)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     35 (ACADS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 35
NCBI-ProteinID: NP_000008
OMIM: 606885
HGNC: 90
Ensembl: ENSG00000122971
Vega: OTTHUMG00000169203
Pharos: P16219(Tbio)
UniProt: P16219 E5KSD5
Structure
PDB: 

Position
12q24.31
AA seq 412 aa AA seqDB search
MAAALLARASGPARRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQV
DKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNN
SLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLN
GTKAWITNAWEASAAVVFASTDRALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSSTAN
LIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAF
GAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAIS
HQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgctgctcgcccgggcctcgggccctgcccgcagagctctctgtcctagg
gcctggcggcagttacacaccatctaccagtctgtggaactgcccgagacacaccagatg
ttgctccagacatgccgggactttgccgagaaggagttgtttcccattgcagcccaggtg
gataaggaacatctcttcccagcggctcaggtgaagaagatgggcgggcttgggcttctg
gccatggacgtgcccgaggagcttggcggtgctggcctcgattacctggcctacgccatc
gccatggaggagatcagccgtggctgcgcctccaccggagtcatcatgagtgtcaacaac
tctctctacctggggcccatcttgaagtttggctccaaggagcagaagcaggcgtgggtc
acgcctttcaccagtggtgacaaaattggctgctttgccctcagcgaaccagggaacggc
agtgatgcaggagctgcgtccaccaccgcccgggccgagggcgactcatgggttctgaat
ggaaccaaagcctggatcaccaatgcctgggaggcttcggctgccgtggtctttgccagc
acggacagagccctgcaaaacaagggcatcagtgccttcctggtccccatgccaacgcct
gggctcacgttggggaagaaagaagacaagctgggcatccggggctcatccacggccaac
ctcatctttgaggactgtcgcatccccaaggacagcatcctgggggagccagggatgggc
ttcaagatagccatgcaaaccctggacatgggccgcatcggcatcgcctcccaggccctg
ggcattgcccagaccgccctcgattgtgctgtgaactacgctgagaatcgcatggccttc
ggggcgcccctcaccaagctccaggtcatccagttcaagttggcagacatggccctggcc
ctggagagtgcccggctgctgacctggcgcgctgccatgctgaaggataacaagaagcct
ttcatcaaggaggcagccatggccaagctggccgcctcggaggccgcgaccgccatcagc
caccaggccatccagatcctgggcggcatgggctacgtgacagagatgccggcagagcgg
cactaccgcgacgcccgcatcactgagatctacgagggcaccagcgaaatccagcggctg
gtgatcgccgggcatctgctcaggagctaccggagctga

DBGET integrated database retrieval system