KEGG   Homo sapiens (human): 3575Help
Entry
3575              CDS       T01001                                 

Gene name
IL7R, CD127, CDW127, IL-7R-alpha, IL7RA, ILRA
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
hsa05340  Primary immunodeficiency
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3575 (IL7R)
   04068 FoxO signaling pathway
    3575 (IL7R)
   04151 PI3K-Akt signaling pathway
    3575 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3575 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3575 (IL7R)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3575 (IL7R)
  09163 Immune diseases
   05340 Primary immunodeficiency
    3575 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3575 (IL7R)
   04090 CD molecules [BR:hsa04090]
    3575 (IL7R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3575 (IL7R)
CD molecules [BR:hsa04090]
 Proteins
  3575 (IL7R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FN3_7 fn3
Motif
Other DBs
NCBI-GeneID: 3575
NCBI-ProteinID: NP_002176
OMIM: 146661
HGNC: 6024
Ensembl: ENSG00000168685
Vega: OTTHUMG00000090791
Pharos: P16871(Tbio)
UniProt: P16871
Structure
PDB: 

Position
5p13.2
AA seq 459 aa AA seqDB search
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTH
VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatggttttttctttacttcaagtcgtttctgga
gaaagtggctatgctcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcgcagcactcactgacctgtgcttttgag
gacccagatgtcaacatcaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgaatttcaggaaactacaagagatatatttcatcgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggagaaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctgagtgtcgtctatcgg
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtatgta
aaagttttaatgcacgatgtagcttaccgccaggaaaaggatgaaaacaaatggacgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaagctccaaccggcagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagtgaatgg
agtccaagttattacttcagaactccagagatcaataatagctcaggggagatggatcct
atcttactaaccatcagcattttgagttttttctctgtcgctctgttggtcatcttggcc
tgtgtgttatggaaaaaaaggattaagcctatcgtatggcccagtctccccgatcataag
aagactctggaacatctttgtaagaaaccaagaaaaaatttaaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggttttctgcaagatacgtttcctcagcaactagaagaatctgagaagcagaggctt
ggaggggatgtgcagagccccaactgcccatctgaggatgtagtcatcactccagaaagc
tttggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgacgcccct
attctctcctcttccaggtccctagactgcagggagagtggcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcacgctgccccctccattttct
ctccaatctggaatcctgacattgaacccagttgctcagggtcagcccattcttacttcc
ctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

DBGET integrated database retrieval system