KEGG   Homo sapiens (human): 3608Help
Entry
3608              CDS       T01001                                 

Gene name
ILF2, NF45, PRO3063
Definition
(RefSeq) interleukin enhancer binding factor 2
  KO
K13089  interleukin enhancer-binding factor 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3608 (ILF2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   General mRNP proteins
    3608 (ILF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DZF SMODS NTP_transf_2
Motif
Other DBs
NCBI-GeneID: 3608
NCBI-ProteinID: NP_004506
OMIM: 603181
HGNC: 6037
Ensembl: ENSG00000143621
Vega: OTTHUMG00000037087
Pharos: Q12905(Tbio)
UniProt: Q12905 F4ZW62 Q53FG3
Position
1q21.3
AA seq 390 aa AA seqDB search
MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKR
NQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVA
DLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTV
PPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPL
TPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHT
VMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEK
PPEKKEGEEEEENTEEPPQGEEEESMETQE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtgacagaggccgtggtcgtggtgggcgctttggttccagaggaggcccagga
ggagggttcaggccctttgtaccacatatcccatttgacttctatttgtgtgaaatggcc
tttccccgggtcaagccagcacctgatgaaacttccttcagtgaggccttgctgaagagg
aatcaggacctggctcccaattctgctgaacaggcatctatcctttctctggtgacaaaa
ataaacaatgtgattgataatctgattgtggctccagggacatttgaagtgcaaattgaa
gaagttcgacaggtgggatcctataaaaaggggacaatgactacaggacacaatgtggct
gacctggtggtgatactcaagattctgccaacgttggaagctgttgctgccctggggaac
aaagtcgtggaaagcctaagagcacaggatccttctgaagttttaaccatgctgaccaac
gaaactggctttgaaatcagttcttctgatgctacagtgaagattctcattacaacagtg
ccacccaatcttcgaaaactggatccagaactccatttggatatcaaagtattgcagagt
gccttagcagccatccgacatgcccgctggttcgaggaaaatgcttctcagtccacagtt
aaagttctcatcagactactgaaggacttgaggattcgttttcctggctttgagcccctc
acaccctggatccttgacctactaggccattatgctgtgatgaacaaccccaccagacag
cctttggccctaaacgttgcatacaggcgctgcttgcagattctggctgcaggactgttc
ctgccaggttcagtgggtatcactgacccctgtgagagtggcaactttagagtacacaca
gtcatgaccctagaacagcaggacatggtctgctatacagctcagactctcgtccgaatc
ctctcacatggtggctttaggaagatccttggccaggagggtgatgccagctatcttgct
tctgaaatatctacctgggatggagtgatagtaacaccttcagaaaaggcttatgagaag
ccaccagagaagaaggaaggagaggaagaagaggagaatacagaagaaccacctcaagga
gaggaagaagaaagcatggaaactcaggagtga

DBGET integrated database retrieval system