KEGG   Homo sapiens (human): 3611Help
Entry
3611              CDS       T01001                                 

Gene name
ILK, HEL-S-28, ILK-1, ILK-2, P59, p59ILK
Definition
(RefSeq) integrin linked kinase
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa05100  Bacterial invasion of epithelial cells
hsa05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3611 (ILK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    3611 (ILK)
  09158 Development
   04360 Axon guidance
    3611 (ILK)
 09160 Human Diseases
  09162 Cancers: Specific types
   05213 Endometrial cancer
    3611 (ILK)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    3611 (ILK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3611 (ILK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3611 (ILK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3611 (ILK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   3611 (ILK)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    3611 (ILK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ank_5 Ank_4 Pkinase Ank_2 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 3611
NCBI-ProteinID: NP_001014794
OMIM: 602366
HGNC: 6040
Ensembl: ENSG00000166333
Vega: OTTHUMG00000133407
Pharos: Q13418(Tbio)
UniProt: Q13418 V9HWF0
Structure
PDB: 

Position
11p15.4
AA seq 452 aa AA seqDB search
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcagtcgccgttcgcctgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagagggccgctctgctgtggttgagatgttgatcatgcggggggcacggatc
aatgtaatgaaccgtggggatgacacccccctgcatctggcagccagtcatggacaccgt
gatattgtacagaagctattgcagtacaaggcagacatcaatgcagtgaatgaacacggg
aatgtgcccctgcactatgcctgtttttggggccaagatcaagtggcagaggacctggtg
gcaaatggggcccttgtcagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccctgagagagcttctccgagagcgggcagagaagatgggccagaatctcaac
cgtattccatacaaggacacattctggaaggggaccacccgcactcggccccgaaatgga
accctgaacaaacactctggcattgacttcaaacagcttaacttcctgacgaagctcaac
gagaatcactctggagagctatggaagggccgctggcagggcaatgacattgtcgtgaag
gtgctgaaggttcgagactggagtacaaggaagagcagggacttcaatgaagagtgtccc
cggctcaggattttctcgcatccaaatgtgctcccagtgctaggtgcctgccagtctcca
cctgctcctcatcctactctcatcacacactggatgccgtatggatccctctacaatgta
ctacatgaaggcaccaatttcgtcgtggaccagagccaggctgtgaagtttgctttggac
atggcaaggggcatggccttcctacacacactagagcccctcatcccacgacatgcactc
aatagccgtagtgtaatgattgatgaggacatgactgcccgaattagcatggctgatgtc
aagttctctttccaatgtcctggtcgcatgtatgcacctgcctgggtagcccccgaagct
ctgcagaagaagcctgaagacacaaacagacgctcagcagacatgtggagttttgcagtg
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaatatggagatt
ggaatgaaggtggcattggaaggccttcggcctaccatcccaccaggtatttcccctcat
gtgtgtaagctcatgaagatctgcatgaatgaagaccctgcaaagcgacccaaatttgac
atgattgtgcctatccttgagaagatgcaggacaagtag

DBGET integrated database retrieval system