KEGG   Homo sapiens (human): 3614Help
Entry
3614              CDS       T01001                                 

Gene name
IMPDH1, IMPD, IMPD1, IMPDH-I, LCA11, RP10, sWSS2608
Definition
(RefSeq) inosine monophosphate dehydrogenase 1
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Disease
H00527  Retinitis pigmentosa
H00837  Leber congenital amaurosis
Drug target
Merimepodib: D04936
Mizoribine: D01392
Mycophenolic acid (DG00739): D00752 D05094 D05095 D05096
Tiazofurine: D06130
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    3614 (IMPDH1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    3614 (IMPDH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3614 (IMPDH1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     3614 (IMPDH1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3614 (IMPDH1)
  Exosomal proteins of breast cancer cells
   3614 (IMPDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth NanE ThiG Glu_synthase DHO_dh G3P_antiterm
Motif
Other DBs
NCBI-GeneID: 3614
NCBI-ProteinID: NP_001136045
OMIM: 146690
HGNC: 6052
Ensembl: ENSG00000106348
Vega: OTTHUMG00000157713
Pharos: P20839(Tclin)
UniProt: P20839
Structure
PDB: 

Position
7q32.1
AA seq 514 aa AA seqDB search
MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKIT
LKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVV
LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMT
PRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDS
QKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVI
GGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVP
IIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM
EKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLR
SMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcggactacctgatcagcggcggcaccggctacgtgcccgaggatgggctcaccgcg
cagcagctcttcgccagcgccgacggcctcacctacaacgacttcctgattctcccagga
ttcatagacttcatagctgatgaggtggacctgacctcagccctgacccggaagatcacg
ctgaagacgccactgatctcctcccccatggacactgtgacagaggctgacatggccatt
gccatggctctgatgggaggtattggtttcattcaccacaactgcaccccagagttccag
gccaacgaggtgcggaaggtcaagaagtttgaacagggcttcatcacggaccctgtggtg
ctgagcccctcgcacactgtgggcgatgtgctggaggccaagatgcggcatggcttctct
ggcatccccatcactgagacgggcaccatgggcagcaagctggtgggcatcgtcacctcc
cgagacatcgactttcttgctgagaaggaccacaccaccctcctcagtgaggtgatgacg
ccaaggattgaactggtggtggctccagcaggtgtgacgttgaaagaggcaaatgagatc
ctgcagcgtagcaagaaagggaagctgcctatcgtcaatgattgcgatgagctggtggcc
atcatcgcccgcaccgacctgaagaagaaccgagactaccctctggcctccaaggattcc
cagaagcagctgctctgtggggcagctgtgggcacccgtgaggatgacaaataccgtctg
gacctgctcacccaggcgggcgtcgacgtcatagtcttggactcgtcccaagggaattcg
gtgtatcagatcgccatggtgcattacatcaaacagaagtacccccacctccaggtgatt
ggggggaacgtggtgacagcagcccaggccaagaacctgattgatgctggtgtggacggg
ctgcgcgtgggcatgggctgcggctccatctgcatcacccaggaagtgatggcctgtggt
cggccccagggcactgctgtgtacaaggtggctgagtatgcccggcgctttggtgtgccc
atcatagccgatggcggcatccagaccgtgggacacgtggtcaaggccctggcccttgga
gcctccacagtgatgatgggctccctgctggccgccactacggaggcccctggcgagtac
ttcttctcagacggggtgcggctcaagaagtaccggggcatgggctcactggatgccatg
gagaagagcagcagcagccagaaacgatacttcagcgagggggataaagtgaagatcgcg
cagggtgtctcgggctccatccaggacaaaggatccattcagaagttcgtgccctacctc
atagcaggcatccaacacggctgccaggatatcggggcccgcagcctgtctgtccttcgg
tccatgatgtactcaggagagctcaagtttgagaagcggaccatgtcggcccagattgag
ggtggtgtccatggcctgcactcttacgaaaagcggctgtactga

DBGET integrated database retrieval system