KEGG   Homo sapiens (human): 364Help
Entry
364               CDS       T01001                                 

Gene name
AQP7, AQP7L, AQPap, GLYCQTL
Definition
(RefSeq) aquaporin 7
  KO
K08771  aquaporin-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
Disease
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    364 (AQP7)
   03320 PPAR signaling pathway
    364 (AQP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    364 (AQP7)
Transporters [BR:hsa02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    364 (AQP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP PNTB
Motif
Other DBs
NCBI-GeneID: 364
NCBI-ProteinID: NP_001161
OMIM: 602974
HGNC: 640
Ensembl: ENSG00000165269
Vega: OTTHUMG00000019773
Pharos: O14520(Tbio)
UniProt: O14520
Position
9p13.3
AA seq 342 aa AA seqDB search
MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVL
NKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQF
LGSFLAAATIYSLFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTG
MLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGYAINPSRDLPPRIFTFIA
GWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITV
LPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagcatccgggcacaggcggtccacccgtggctccaaaatggtctcctggtcc
gtgatagcaaagatccaggaaatactgcagaggaagatggtgcgagagttcctggccgag
ttcatgagcacatatgtcatgatggtattcggccttggttccgtggcccatatggttcta
aataaaaaatatgggagctaccttggtgtcaacttgggttttggcttcggagtcaccatg
ggagtgcacgtggcaggccgcatctctggagcccacatgaacgcagctgtgacctttgct
aactgtgcgctgggccgcgtgccctggaggaagtttccggtctatgtgctggggcagttc
ctgggctccttcctggcggctgccaccatctacagtctcttctacacggccattctccac
ttttcgggtggacagctgatggtgaccggtcccgtcgctacagctggcatttttgccacc
taccttcctgatcacatgacattgtggcggggcttcctgaatgaggcgtggctgaccggg
atgctccagctgtgtctcttcgccatcacggaccaggagaacaacccagcactgccagga
acagaggcgctggtgataggcatcctcgtggtcatcatcggggtgtcccttggcatgaac
acaggatatgccatcaacccgtcccgggacctgcccccccgcatcttcaccttcattgct
ggttggggcaaacaggtcttcagcaatggggagaactggtggtgggtgccagtggtggca
ccacttctgggtgcctatctaggtggcatcatctacctggtcttcattggctccaccatc
ccacgggagcccctgaaattggaggattctgtggcgtatgaagaccacgggataaccgta
ttgcccaagatgggatctcatgaacccacgatctctcccctcacccccgtctctgtgagc
cctgccaacagatcttcagtccaccctgccccacccttacatgaatccatggccctagag
cacttctaa

DBGET integrated database retrieval system