KEGG   Homo sapiens (human): 3702
Entry
3702              CDS       T01001                                 

Symbol
ITK, EMT, LPFS1, LYK, PSCTK2
Name
(RefSeq) IL2 inducible T cell kinase
  KO
K07363  IL2-inducible T-cell kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04670  Leukocyte transendothelial migration
Disease
H00107  Other well-defined immunodeficiency syndromes
H01970  Lymphoproliferative syndrome 1
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    3702 (ITK)
   04670 Leukocyte transendothelial migration
    3702 (ITK)
   04062 Chemokine signaling pathway
    3702 (ITK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3702 (ITK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3702 (ITK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  TEC family
   3702 (ITK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_10 SH3_2 PH_8 SH3_3 SH3_4 PH_3 APH
Other DBs
NCBI-GeneID: 3702
NCBI-ProteinID: NP_005537
OMIM: 186973
HGNC: 6171
Ensembl: ENSG00000113263
Vega: OTTHUMG00000130245
Pharos: Q08881(Tclin)
UniProt: Q08881
Structure
PDB: 

Position
5q33.3
AA seq 620 aa
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaacaactttatcctcctggaagaacagctcatcaagaaatcccaacaaaagagaaga
acttctccctcgaactttaaagtccgcttctttgtgttaaccaaagccagcctggcatac
tttgaagatcgtcatgggaagaagcgcacgctgaaggggtccattgagctctcccgaatc
aaatgtgttgagattgtgaaaagtgacatcagcatcccatgccactataaatacccgttt
caggtggtgcatgacaactacctcctatatgtgtttgctccagatcgtgagagccggcag
cgctgggtgctggcccttaaagaagaaacgaggaataataacagtttggtgcctaaatat
catcctaatttctggatggatgggaagtggaggtgctgttctcagctggagaagcttgca
acaggctgtgcccaatatgatccaaccaagaatgcttcaaagaagcctcttcctcctact
cctgaagacaacaggcgaccactttgggaacctgaagaaactgtggtcattgccttatat
gactaccaaaccaatgatcctcaggaactcgcactgcggcgcaacgaagagtactgcctg
ctggacagttctgagattcactggtggagagtccaggacaggaatgggcatgaaggatat
gtaccaagcagttatctggtggaaaaatctccaaataatctggaaacctatgagtggtac
aataagagtatcagccgagacaaagctgaaaaacttcttttggacacaggcaaagaagga
gccttcatggtaagggattccaggactgcaggaacatacaccgtgtctgttttcaccaag
gctgttgtaagtgagaacaatccctgtataaagcattatcacatcaaggaaacaaatgac
aatcctaagcgatactatgtggctgaaaagtatgtgttcgattccatccctcttctcatc
aactatcaccaacataatggaggaggcctggtgactcgactccggtatccagtttgtttt
gggaggcagaaagccccagttacagcagggctgagatacgggaaatgggtgatcgacccc
tcagagctcacttttgtgcaagagattggcagtgggcaatttgggttggtgcatctgggc
tactggctcaacaaggacaaggtggctatcaaaaccattcgggaaggggctatgtcagaa
gaggacttcatagaggaggctgaagtaatgatgaaactctctcatcccaaactggtgcag
ctgtatggggtgtgcctggagcaggcccccatctgcctggtgtttgagttcatggagcac
ggctgcctgtcagattatctacgcacccagcggggactttttgctgcagagaccctgctg
ggcatgtgtctggatgtgtgtgagggcatggcctacctggaagaggcatgtgtcatccac
agagacttggctgccagaaattgtttggtgggagaaaaccaagtcatcaaggtgtctgac
tttgggatgacaaggttcgttctggatgatcagtacaccagttccacaggcaccaaattc
ccggtgaagtgggcatccccagaggttttctctttcagtcgctatagcagcaagtccgat
gtgtggtcatttggtgtgctgatgtgggaagttttcagtgaaggcaaaatcccgtatgaa
aaccgaagcaactcagaggtggtggaagacatcagtaccggatttcggttgtacaagccc
cggctggcctccacacacgtctaccagattatgaatcactgctggaaagagagaccagaa
gatcggccagccttctccagactgctgcgtcaactggctgaaattgcagaatcaggactt
tag

KEGG   Homo sapiens (human): 7294
Entry
7294              CDS       T01001                                 

Symbol
TXK, BTKL, PSCTK5, PTK4, RLK, TKL
Name
(RefSeq) TXK tyrosine kinase
  KO
K08016  tyrosine-protein kinase TXK [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7294 (TXK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7294 (TXK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     7294 (TXK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  TEC family
   7294 (TXK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10
Other DBs
NCBI-GeneID: 7294
NCBI-ProteinID: NP_003319
OMIM: 600058
HGNC: 12434
Ensembl: ENSG00000074966
Vega: OTTHUMG00000102065
Pharos: P42681(Tchem)
UniProt: P42681
Structure
PDB: 
2DM0

Position
4p12
AA seq 527 aa
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatcctttcctcctataacaccatccagtcggttttctgttgctgctgttgctgttca
gtgcagaagcgacaaatgagaacacagataagcctgagcacagatgaagagcttccagaa
aaatacacccagcgtcgcaggccgtggctcagccaattgtcaaataagaagcaatccaac
acgggccgtgtgcagccgtcaaaacgaaagccactgcctcccctcccaccctctgaggtt
gctgaagagaagatccaagtcaaggcactttatgattttctgcccagagaaccctgtaat
ttagccttaaggagagcagaagaatacctgatactggagaaatacaatcctcactggtgg
aaggcaagagaccgtttggggaatgaaggcttaatcccaagcaactatgtgactgaaaac
aaaataactaatttagaaatatatgagtggtaccatagaaacattaccagaaatcaggca
gaacatctattgagacaagagtctaaagaaggtgcatttattgtcagagattcaagacat
ttaggatcctacacaatttccgtatttatgggagctagaagaagtacggaggctgccata
aaacattatcagataaaaaagaatgactcaggacagtggtatgtggctgaaagacacgcc
tttcaatcaatccctgagttaatctggtatcaccagcacaatgcagccggtctcatgact
cgtctccgatatccagttgggctgatgggcagttgtttaccagccacagctgggtttagc
tacgaaaagtgggagatagatccatctgagttggcttttataaaggagattggaagcggt
cagtttggagtggtccatttaggtgaatggcggtcacatatccaggtagctatcaaggcc
atcaatgaaggctccatgtctgaagaggatttcattgaagaggccaaagtgatgatgaaa
ttatctcattcaaagctagtgcaactttatggagtctgtatacagcggaagcccctttac
attgtgacagagttcatggaaaatggctgcctgcttaactatctcagggagaataaagga
aagcttaggaaggaaatgctactgagtgtatgccaggatatatgtgaaggaatggaatat
ctggagaggaatggctatattcatagggatttggcggcaaggaattgtttggtcagttca
acatgcatagtaaaaatttcagactttggaatgacaaggtacgttttggatgatgagtat
gtcagttcttttggagccaagttcccaatcaagtggtcccctcctgaagtttttcttttc
aataagtacagcagtaaatctgatgtctggtcatttggagttttaatgtgggaagttttt
acagaaggaaaaatgccttttgaaaataagtcaaatttgcaagtcgtggaagctatttct
gaaggcttcaggctatatcgccctcacctggcaccaatgtccatatatgaagtcatgtac
agctgctggcatgagaaacctgaaggccgccctacatttgccgagctgctgcgggctgtc
acagagattgcggaaacctggtga

DBGET integrated database retrieval system