KEGG   Homo sapiens (human): 3716Help
Entry
3716              CDS       T01001                                 

Gene name
JAK1, JAK1A, JAK1B, JTK3
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04621  NOD-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05212  Pancreatic cancer
Module
hsa_M00684  JAK-STAT signaling
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00150  Type I IFN signaling pathway
N00267  HBV HBx to host-cell-protein activation
Drug target
Baricitinib: D10308
Delgocitinib: D11046
Filgotinib (DG01991): D10871 D10872
Itacitinib (DG02833): D10944 D10945
Momelotinib (DG01366): D10315 D10358
Oclacitinib (DG02005): D10141 D10142
Peficitinib (DG01853): D10653 D10721
Ruxolitinib (DG00719): D09959 D09960
Solcitinib: D10728
Tofacitinib (DG00742): D09783 D09970
Upadacitinib (DG02829): D10994 D10995 D11048
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3716 (JAK1)
   04151 PI3K-Akt signaling pathway
    3716 (JAK1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3716 (JAK1)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3716 (JAK1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    3716 (JAK1)
   04658 Th1 and Th2 cell differentiation
    3716 (JAK1)
   04659 Th17 cell differentiation
    3716 (JAK1)
  Development
   04380 Osteoclast differentiation
    3716 (JAK1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3716 (JAK1)
   05203 Viral carcinogenesis
    3716 (JAK1)
   05212 Pancreatic cancer
    3716 (JAK1)
  Infectious diseases
   05152 Tuberculosis
    3716 (JAK1)
   05166 HTLV-I infection
    3716 (JAK1)
   05162 Measles
    3716 (JAK1)
   05164 Influenza A
    3716 (JAK1)
   05161 Hepatitis B
    3716 (JAK1)
   05160 Hepatitis C
    3716 (JAK1)
   05168 Herpes simplex infection
    3716 (JAK1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3716 (JAK1)
   05169 Epstein-Barr virus infection
    3716 (JAK1)
   05165 Human papillomavirus infection
    3716 (JAK1)
   05145 Toxoplasmosis
    3716 (JAK1)
   05140 Leishmaniasis
    3716 (JAK1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    3716 (JAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3716 (JAK1)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   3716 (JAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 FERM_M
Motif
Other DBs
NCBI-GeneID: 3716
NCBI-ProteinID: NP_001307852
OMIM: 147795
HGNC: 6190
Ensembl: ENSG00000162434
Vega: OTTHUMG00000009310
Pharos: P23458(Tclin)
UniProt: P23458 Q6P669
Structure
PDB: 

Position
1p31.3
AA seq 1154 aa AA seqDB search
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggcccctgagccaggggtggaagtgatcttc
tatctgtcggacagggagcccctccggctgggcagtggagagtacacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctctcctctttgtcacaacctctttgccctg
tatgacgagaacaccaagctctggtatgctccaaatcgcaccatcaccgttgatgacaag
atgtccctccggctccactaccggatgaggttctatttcaccaattggcatggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctacgagaaa
aaaaagattccagatgcaacccctctccttgatgccagctcactggagtatctgtttgct
cagggacagtatgatttggtgaaatgcctggctcctattcgagaccccaagaccgagcag
gatggacatgatattgagaacgagtgtctagggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacttggctaccttggaaactttgacaaaacat
tacggtgctgaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcattcgaatgacggtggaaacgttctctactacgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaaataaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctctcttcccacgag
gaggccttgtcctttgtgtccctggtagatggctacttccggctcacagcagatgcccat
cattacctctgcaccgacgtggcccccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggtgcagggtgcccagaagcagttcaagaactttcagatc
gaggtgcagaagggccgctacagtctgcacggttcggaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgcta
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gcccaggagtggcagcccgtctaccccatgagccagctgagtttcgatcggatcctcaag
aaggatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctattctggg
accctgatggattacaaggatgacgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccccagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgcgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagcgatgtccttaccacaccatggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaggataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgagggcatcgacagtgagtgtggcccattcatcaagctcagtgacccc
ggcatccccattacggtgctgtctaggcaagaatgcattgaacgaatcccatggattgct
cctgagtgtgttgaggactccaagaacctgagtgtggctgctgacaagtggagctttgga
accacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacgctgatt
gagaaagagagattctatgaaagccggtgcaggccagtgacaccatcatgtaaggagctg
gctgacctcatgacccgctgcatgaactatgaccccaatcagaggcctttcttccgagcc
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaaa
ccagcaactgaagtggaccccacacattttgaaaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgttaaatctctgaagcctgagagtggaggtaaccacatagct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcatgagaacattgtgaagtac
aaaggaatctgcacagaagacggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggaatatcttccaaagaataagaacaaaataaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatacgtt
caccgggacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gacttcggtttaaccaaagcaattgaaaccgataaggagtattacaccgtcaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatatt
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgattca
gattctagtcccatggctttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacgttaaaagaaggaaaacgcctgccgtgcccacctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system