KEGG   Homo sapiens (human): 374900
Entry
374900            CDS       T01001                                 
Symbol
ZNF568, ZFP568
Name
(RefSeq) zinc finger protein 568
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    374900 (ZNF568)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    374900 (ZNF568)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    374900 (ZNF568)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_jaz zf-C2HE zf-C2H2_11 zf_UBZ HVO_2753_ZBP zf-AN1 C1_4 Zn_Tnp_IS1595
Other DBs
NCBI-GeneID: 374900
NCBI-ProteinID: NP_940941
OMIM: 617566
HGNC: 25392
Ensembl: ENSG00000198453
UniProt: Q3ZCX4 Q96AZ9
Structure
Position
19:36916332..36997932
AA seq 644 aa
MTSQSSVISNSCVTMERLSHMMERKAWCSQESALSEEEEDTTRPLETVTFKDVAVDLTQE
EWEQMKPAQRNLYRDVMLENYSNLVTVGCQVTKPDVIFKLEQEEEPWVMEEEMFGRHCPE
VWEVDEQIKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVTSRQSFYDCDS
LDKGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRH
ERIHAGEKPYECKECGKAFSRKENLITHQKIHTGEKPYKCNECGKAFIQMSNLIRHHRIH
TGEKPYACKDCWKAFSQKSNLIEHERIHTGEKPYECKECGKSFSQKQNLIEHEKIHTGEK
PYACNECGRAFSRMSSVTLHMRSHTGEKPYKCNKCGKAFSQCSVFIIHMRSHTGEKPYVC
SECGKAFSQSSSLTVHMRNHTAEKPYECKECGKAFSRKENLITHQKIHTGEKPYECSECG
KAFIQMSNLIRHQRIHTGEKPYACTVCGKAFSQKSNLTEHEKIHTGEKPYHCNQCGKAFS
QRQNLLEHEKIHTGEKPFKCNECGKAFSRISSLTLHVRSHTGEKPYECNKCGKAFSQCSL
LIIHMRSHTGEKPFECNECGKAFSQRASLSIHKRGHTGERHQVY
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgacatctcaatcttcagtgatcagcaatagctgtgtgacaatggagcgtttgagccac
atgatggaaaggaaagcttggtgttctcaagagtctgccctttccgaggaagaagaggat
acaaccaggcctcttgaaacagtgacatttaaggatgtggctgttgaccttacccaggag
gagtgggagcaaatgaaacctgctcaaagaaacttgtatcgagatgtgatgctggagaac
tacagcaacctagtcacagtgggctgtcaagtcaccaaaccggatgtgatattcaagttg
gagcaagaagaggagccctgggtgatggaggaagaaatgtttgggaggcactgtccagaa
gtttgggaagttgatgaacagatcaagaagcaacaggaaacacttgtgaggaaagtcaca
tccatctccaagaaaattctgataaaggaaaaagtcattgaatgtaaaaaagttgcgaaa
atatttcctctgagttcagacattgttacttcaagacaaagcttctatgactgtgactca
cttgataagggtttggaacataatttagacttacttagatatgagaaaggctgtgtaaga
gagaaacagagtaatgagtttgggaaaccattttaccattgtgcatcctatgttgtaacc
ccctttaagtgtaatcagtgtggacaagacttcagtcataaatttgacctcattagacat
gagcgaattcatgctggagagaaaccttacgaatgtaaagaatgtggaaaagccttcagt
aggaaggaaaatcttattacacatcagaaaattcatactggggaaaaaccgtataagtgt
aatgaatgtggaaaagctttcattcagatgtcaaaccttattagacaccacagaattcat
actggggagaaaccttatgcatgtaaggattgttggaaagccttcagtcagaaatcaaat
ctcattgaacatgagcgaattcacactggagagaaaccctatgaatgtaaggaatgtggg
aaatccttcagccagaagcaaaatcttattgagcacgagaaaattcatactggggagaaa
ccttatgcatgtaatgaatgtggtagagctttttctcgaatgtcatctgttacgctacat
atgagaagtcacacaggggagaaaccctataaatgtaataaatgtggaaaagctttctct
caatgctcagtatttattatacatatgagaagtcacactggtgagaaaccctatgtatgt
agtgaatgtgggaaagccttctctcagagttcatccctaaccgtacatatgcgaaatcat
acagctgagaaaccctatgaatgtaaggaatgtggaaaagccttcagcaggaaagaaaat
ctcattacacatcagaaaattcacactggagagaaaccttatgaatgcagtgaatgtggg
aaagcttttattcagatgtcaaacctcattcgacaccagagaattcatacgggtgagaaa
ccctatgcatgtacagtatgtggaaaagcctttagtcagaaatcaaacctcactgaacat
gagaaaattcatactggagagaaaccttatcattgtaatcaatgtgggaaagctttcagt
cagagacaaaatcttcttgagcatgaaaaaattcatactggagagaaaccattcaaatgt
aatgaatgtggtaaagccttctctcgaatctcatccctcactcttcatgtgagaagtcac
acaggggagaaaccctatgaatgtaataaatgtgggaaagccttttctcagtgctcatta
cttattatacatatgagaagtcatactggtgagaaaccctttgaatgtaatgaatgtggg
aaagcattctctcaaagagcatccctttctatacataagagaggtcatacaggtgagaga
caccaagtatattaa

DBGET integrated database retrieval system