KEGG   Homo sapiens (human): 3752Help
Entry
3752              CDS       T01001                                 

Gene name
KCND3, BRGDA9, KCND3L, KCND3S, KSHIVB, KV4.3, SCA19, SCA22
Definition
(RefSeq) potassium voltage-gated channel subfamily D member 3
  KO
K04893  potassium voltage-gated channel Shal-related subfamily D member 3
Organism
hsa  Homo sapiens (human)
Disease
H00063  Spinocerebellar ataxia (SCA)
H00728  Brugada syndrome (BRS)
Drug target
Amiodarone (DG00204): D00636 D02910
Bepridil (DG00333): D00631 D07520
Butamben: D00730
Clofilium phosphate: D03547
Dronedarone (DG00207): D02537 D03914
Fampridine: D04127
Nifekalant hydrochloride: D01856
Vernakalant: D06665
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3752 (KCND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3399 Ion_trans BTB_2 Shal-type Ion_trans_2 BTB_3 PKD_channel
Motif
Other DBs
NCBI-GeneID: 3752
NCBI-ProteinID: NP_004971
OMIM: 605411
HGNC: 6239
Ensembl: ENSG00000171385
Vega: OTTHUMG00000011989
Pharos: Q9UK17(Tclin)
UniProt: Q9UK17
Structure
PDB: 

Position
1p13.2
AA seq 655 aa AA seqDB search
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLL
HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHP
GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG
LRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggagttgcggcctggctgccttttgcccgggctgcggccatcgggtggatg
ccggtggccaactgccccatgcccctggccccggccgacaagaacaagcggcaggatgag
ctgattgtcctcaacgtgagtgggcggaggttccagacctggaggaccacgctggagcgc
tacccggacaccctgctgggcagcacggagaaggagttcttcttcaacgaggacaccaag
gagtacttcttcgaccgggaccccgaggtgttccgctgcgtgctcaacttctaccgcacg
gggaagctgcactacccgcgctacgagtgcatctctgcctacgacgacgagctggccttc
tacggcatcctcccggagatcatcggggactgctgctacgaggagtacaaggaccgcaag
agggagaacgccgagcggctcatggacgacaacgactcggagaacaaccaggagtccatg
ccctcgctcagcttccgccagaccatgtggcgggccttcgagaacccccacaccagcacg
ctggccctggtcttctactacgtgactggcttcttcatcgctgtctcggtcatcaccaac
gtggtggagacggtgccgtgcggcacggtcccgggcagcaaggagctgccgtgcggggag
cgctactcggtggccttcttctgcctggacacggcgtgcgtcatgatcttcaccgtggag
tacctcctgcggctcttcgcggctcccagccgctaccgcttcatccgcagcgtcatgagc
atcatcgacgtggtggccatcatgccctactacatcggtctggtcatgaccaacaacgag
gacgtgtccggcgccttcgtcacgctccgggtcttccgcgtcttcaggatcttcaagttt
tcccgccactcccagggcctgcggatcctgggctacacactgaagagctgtgcctccgaa
ctgggctttcttctcttctccctcaccatggccatcatcatctttgccactgtgatgttt
tatgccgagaagggctcctcggccagcaagttcacaagcatccctgcctcgttttggtac
accattgtcaccatgaccacactgggatacggagacatggtgcctaagacgattgcaggg
aagatcttcggctccatctgctccttgagtggcgtcctggtcattgccctgccagtccct
gtgattgtttccaactttagccggatttaccaccagaatcagagagctgataaacgcagg
gcacaaaagaaggcccgccttgccaggatccgtgtggccaaaacaggcagttcgaatgca
tacctgcacagcaagcgcaacgggctcctcaacgaggcgctggagctgacgggcacccca
gaagaggagcacatgggcaagaccacctcactcatcgagagccagcatcatcacctgctg
cactgcctggaaaaaaccactgggttgtcctatcttgtggatgatcccctgttatctgta
cgaacctccaccatcaagaaccacgagtttattgatgagcagatgtttgagcagaactgc
atggagagttcaatgcagaactacccatccacaagaagtccctcactgtccagccaccca
ggcctcactaccacctgctgctcccgtcgtagtaagaagaccacacacctgcccaattct
aacctgccagctactcgcctgcgcagcatgcaagagctcagcacgatccacatccagggc
agtgagcagccctccctcacaaccagtcgctccagccttaatttgaaagcagacgacgga
ctgagaccaaactgcaaaacatcccagatcaccacagccatcatcagcatccccactccc
ccagcgctaaccccagagggggaaagtcggccaccccctgccagcccaggccccaacacg
aacattccttccatagccagcaatgttgtcaaggtctccgccttgtaa

DBGET integrated database retrieval system