KEGG   Homo sapiens (human): 3800Help
Entry
3800              CDS       T01001                                 

Gene name
KIF5C, CDCBM2, KINN, NKHC, NKHC-2, NKHC2
Definition
(RefSeq) kinesin family member 5C
  KO
K10396  kinesin family member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04728  Dopaminergic synapse
hsa05016  Huntington disease
Disease
H01881  Complex cortical dysplasia with other brain malformations
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3800 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    3800 (KIF5C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    3800 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3800 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3800 (KIF5C)
   04147 Exosome [BR:hsa04147]
    3800 (KIF5C)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    3800 (KIF5C)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3800 (KIF5C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3800 (KIF5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 3800
NCBI-ProteinID: NP_004513
OMIM: 604593
HGNC: 6325
Ensembl: ENSG00000168280
Vega: OTTHUMG00000153779
Pharos: O60282(Tbio)
UniProt: O60282 Q59GB8
Position
2q23.1-q23.2
AA seq 957 aa AA seqDB search
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPNTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVI
QHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEE
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAA
KDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELS
NHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEES
QDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSR
LRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQA
REDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDNDDGGGSAAQKQKISFLENN
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggcccctcaacgaa
gcggagatcctccgcggggacaaattcatccccaaatttaaaggcgatgagaccgtggtg
atcgggcaagggaagccatatgtcttcgacagagtgctacctcccaacacgacccaagag
caggtttacaatgcatgtgcgaagcaaattgtcaaagatgtccttgaaggttataacggg
acgatttttgcgtatgggcagacttcatcaggaaaaacccacaccatggaggggaagctg
catgacccccagctcatggggatcatcccacgaattgcccatgatatctttgaccatatc
tactccatggatgagaacctggagtttcacataaaggtttcctattttgagatctacttg
gacaaaataagggacttacttgatgtatccaagaccaacttggctgttcatgaagataaa
aacagagtcccgtatgtaaaggggtgcactgagcggtttgtgtcgagccctgaggaagtc
atggatgtaatagatgaaggcaaagcaaaccgacacgtggctgtgacaaacatgaatgaa
cacagctctagaagtcacagtatcttcctgataaatattaaacaagagaatgtagagact
gaaaaaaaactcagtgggaaactttatttggttgatttggctgggagcgaaaaggtcagc
aaaactggtgccgagggagctgttcttgacgaagctaaaaatatcaataagtctttgtct
gctcttggaaatgtgatctctgctttggcagaagggacaaaaacacatgtgccataccgg
gacagcaagatgactcggattcttcaggactctttgggtgggaactgcagaaccaccatc
gtcatttgctgttctccttctgtcttcaatgaggctgagaccaagtccacactgatgttc
ggacagagagctaagaccatcaagaatacagtctctgtgaacctagaactgacagcagaa
gaatggaagaagaaatatgaaaaagagaaagagaaaaacaagactttgaagaatgttatc
cagcatctggagatggagctaaacaggtggaggaatggagaagctgtgcctgaggatgaa
cagatcagtgccaaggaccagaagaacctggagccttgtgataacacccccatcatagac
aatattgctcctgttgttgctggcatctctacagaggagaaagagaagtacgatgaggag
atctccagtctctacagacaactggatgacaaggatgatgaaattaaccagcagagccag
ctggctgaaaagctgaagcaacagatgttggatcaggatgagcttttagcttccacaaga
agagactatgagaagatacaggaggagctgacacgtctccagattgaaaatgaggcagcc
aaggatgaggtgaaagaagttctccaggccctggaggagctggctgtcaattatgaccag
aaatcacaggaagtggaggataagacccgggccaatgagcagctgacagacgagctggcc
cagaaaacgactacattgacaaccacacagagagagctgagccagctacaagagcttagc
aaccaccagaagaaaagggcaactgagatcctgaatttgctgttgaaagatctgggggag
ataggtggaattattggcaccaatgatgtgaaaactttggcagatgtgaatggagtcatt
gaggaggagtttaccatggcccgcctgtacatcagcaagatgaagtcagaggtcaagtcc
ctggtgaaccgcagcaaacagctcgagagcgcccagatggactccaacaggaagatgaat
gccagcgagcgggagctggcagcctgccagctgctcatctcccagcacgaagccaagatc
aagtctctgacagactacatgcagaacatggaacagaagaggaggcagctagaagagtcc
caggactcgctcagcgaagagctggcaaagctccgagcccaggaaaaaatgcacgaagtc
agcttccaggataaggagaaggaacatctgacgcggttgcaggatgctgaagaaatgaag
aaggcgctggagcagcagatggagagccaccgggaagctcaccagaagcagctgtccaga
ctccgagacgaaattgaggagaagcagaaaatcattgatgagattcgggatttgaatcag
aaactgcaactggaacaggagaagcttagttctgattataacaagctgaaaatagaggac
caagagagagaaatgaagctggaaaagctcttattgctcaacgataaaagggaacaagcc
agagaagacctcaaagggctggaggagacagtgtctagagaattgcagacactgcacaac
cttcggaaactctttgtccaggatctgaccacccgagttaaaaaaagtgtggagttggac
aacgatgatggagggggcagtgctgcccagaagcagaaaatttccttcttggagaataac
ctggagcagctcaccaaagttcacaagcagctggtccgggacaacgcagacctgcgctgt
gaactgcccaagctggagaagcggctgcgtgccacggcggagcgcgtcaaggctctggag
agcgcgctgaaggaggccaaggagaacgccatgcgggaccgtaagcgctaccagcaggag
gtggatcgtatcaaggaggccgtgcgggccaagaacatggccagaagggcccattcagcc
cagatcgccaagcccatccgccccggacactacccggcctcatctccaacggccgtccat
gccattcgagggggaggaggcagctcttcaaattccactcactaccagaaataa

DBGET integrated database retrieval system