KEGG   Homo sapiens (human): 3831Help
Entry
3831              CDS       T01001                                 

Gene name
KLC1, KLC, KNS2, KNS2A
Definition
(RefSeq) kinesin light chain 1
  KO
K10407  kinesin light chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    3831 (KLC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    3831 (KLC1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3831 (KLC1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     3831 (KLC1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3831 (KLC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_16 TPR_8 TPR_MalT TPR_19 TPR_14 TPR_17 ANAPC3 PPR JIP_LZII TMF_TATA_bd GHL5 DUF4919 COG2 TPR_11
Motif
Other DBs
NCBI-GeneID: 3831
NCBI-ProteinID: NP_891553
OMIM: 600025
HGNC: 6387
Ensembl: ENSG00000126214
Vega: OTTHUMG00000169227
Pharos: Q07866(Tbio)
UniProt: Q07866
Structure
PDB: 

Position
14q32.33
AA seq 573 aa AA seqDB search
MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLF
PNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGE
EVSMSVEWNGGVSGRASFCGKRQQQQWPGRRHR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacaacatgtccacaatggtgtacataaaggaagacaagttggagaagcttaca
caggatgaaattatttctaagacaaagcaagtaattcaggggctggaagctttgaagaat
gagcacaattccattttacaaagtttgctggagacactgaagtgtttgaagaaagatgat
gaaagtaatttggtggaggagaaatcaaacatgatccggaagtcactggagatgttggag
ctcggcctgagtgaggcacaggttatgatggctttgtcaaatcacctgaatgctgtggag
tccgagaagcagaaactgcgtgcgcaggttcgtcgtctgtgccaggagaatcagtggcta
cgggatgaactggccaacacgcagcagaaactgcagaagagtgagcagtctgtggctcaa
ctggaggaggagaagaagcatctggagtttatgaatcagctaaaaaaatatgatgacgac
atttccccatccgaggacaaagacactgattctaccaaagagcctctggatgaccttttc
cccaatgatgaagacgacccagggcaaggaatccagcagcagcacagcagtgcagccgcg
gctgcccagcagggcggctacgagatccccgcgcggctgcggacgctccacaacctggtg
atccagtacgcctcgcaggggcgctacgaggtagctgtgcccctctgcaagcaggccctg
gaggacctggagaagacttcaggacacgaccacccggacgtggccaccatgctcaacatc
ctggccttggtgtacagggatcagaataaatacaaagatgcagctaacctactgaatgat
gccttggctattcgtgagaaaactttgggcaaagatcatcctgcggtggcggcgactttg
aataaccttgcagtcctttatggtaaaagagggaagtacaaagaagcagagccgttgtgt
aaaagagctctggaaatccgagaaaaggttttggggaaggatcaccccgatgttgccaag
cagttaaataacttggccttactgtgccagaaccagggcaagtatgaagaagtagaatat
tattatcaaagagccctcgagatctaccagacaaaactgggacctgatgaccccaacgtg
gctaagacgaaaaataacctggcatcctgctatttgaaacaaggaaagttcaagcaagca
gaaacactgtacaaagagattctcactcgtgcacatgaaagggagtttggttctgtagat
gatgaaaataaacccatctggatgcatgctgaagaaagagaagaatgcaaaggaaagcaa
aaggatgggacatcttttggagagtatggcggctggtacaaagcctgcaaagttgatagt
ccaactgttacaaccactctaaaaaaccttggggcactttacagacgtcaaggcaaattt
gaagctgcagaaacgttagaagaagctgctatgaggtctcgtaaacagggtcttgacaat
gttcacaaacagagggtggcagaagtgctcaatgaccctgagaacatggagaagcgcagg
agccgtgagagcctcaacgtggacgtggtcaagtacgagagtggccctgacggaggggag
gaagtgagtatgagcgtagagtggaacgggggcgtctctggccgagcctctttttgtgga
aaacgacagcagcagcagtggcctggaagacgccaccgctaa

DBGET integrated database retrieval system