KEGG   Homo sapiens (human): 3834
Entry
3834              CDS       T01001                                 

Gene name
KIF25, KNSL3
Definition
(RefSeq) kinesin family member 25
  KO
K18627  kinesin family member 25
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3834 (KIF25)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3834 (KIF25)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 3834
NCBI-ProteinID: NP_085118
OMIM: 603815
HGNC: 6390
Ensembl: ENSG00000125337
Vega: OTTHUMG00000016035
Pharos: Q9UIL4(Tdark)
UniProt: Q9UIL4
Position
6q27
AA seq 384 aa
MTWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLLTSLLDGYNVC
VMAYGQTGSGKSYTMLGRHSDDGPVLPLDPQSDLGIIPRVAEELFRLILENTSRSPKVEV
SIVEVYNNDIFDLLAKDSIAAVSGVKREVVTAKDGRTEVALLASEAVGSASKLMELVHGG
LQLRAKHPTLVHADSSRSHLIITVTLTTASCSDSTADQACSATLPREQTEAGRAGRSRRA
SQGALAPQLVPGNPAGHAEQVQARLQLVDSAGSECVGVSGVTGLALREMACISRSLAALA
GVLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTLQGLGFGIRA
RQVQRGPARKKPPSSQTEGKRRPD
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgacatggacctcaggtcagcttcagcgtgagaagcaggccaggcctgggtctggagcc
gtcctggccttcccagatgacaaggacctcagggtttatggtccagcagagtctcagagc
gcggtctttggagatgtgtgccccctactcacttctctcttggatgggtacaatgtttgt
gttatggcgtatggacagacgggcagcggaaagagctataccatgctgggacgccattcg
gacgacggccctgttctgccgcttgacccacagagtgacttaggaattatccctagagtg
gctgaggagctcttcaggctcattttggaaaatacctcaagaagcccaaaggttgaagtc
tccatagtggaagtttacaataatgacatttttgaccttctggccaaagacagcattgca
gcagtgtcgggggtcaagcgtgaggtggtgacagccaaggatggacggacagaggttgcg
ctgctggcctctgaggctgtcggcagcgcctcgaaactgatggagctcgttcatggaggt
ctgcagctcagggcgaagcaccccaccctggtgcacgcggattcctccaggtctcacctg
ataattacggtgactctaaccacagcctcctgctctgacagcactgcagaccaagcctgc
agtgccaccctccccagggagcaaacagaggcaggaagggcaggaaggagccgcagagct
tctcaaggggccttggctccacagctggttcctgggaaccccgcagggcatgcggagcag
gtgcaggctcgactacagctcgtggactcggccggcagcgagtgcgttggtgtgtctgga
gtgaccgggttggccctgagggagatggcgtgcatcagccgcagccttgcggccctggca
ggcgtcctgggggctttgttggagcaccgtggccatgccccgtaccggaacagcaggctc
acccacctccttcaggactgcctcggaggcgatgcgaagttactggtgattctctgcatt
tctcccagccagaggcacctggcacagacgttgcagggcctgggtttcgggatccgagct
cggcaagtccagcgaggccctgcccgaaagaagccgcccagctcccaaacggaggggaag
aggaggccggattga

DBGET integrated database retrieval system