KEGG   Homo sapiens (human): 388536
Entry
388536            CDS       T01001                                 
Symbol
ZNF790
Name
(RefSeq) zinc finger protein 790
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    388536 (ZNF790)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    388536 (ZNF790)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    388536 (ZNF790)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf_UBZ zf-trcl zf-C2H2_11
Other DBs
NCBI-GeneID: 388536
NCBI-ProteinID: NP_001229729
HGNC: 33114
Ensembl: ENSG00000197863
UniProt: Q6PG37 B4DMI3
Position
19:complement(36817428..36850792)
AA seq 636 aa
MAHLMMFRDVAVDFSQEEWECLDLEQRDLYRDVMLENYSNMVSLGFCIYQPEAFSLLEKG
KEPWKILRDETRGPCPDMQSRCQTKKLLPKNGIFEREIAQLEIMRICKNHSLDCLCFRGD
WEGNTQFQTLQDNQEECFKQVIRTCEKRPTFNQHTVFNLHQRLNTGDKLNEFKELGKAFI
SGSDHTQHQLIHTSEKFCGDKECGNTFLPDSEVIQYQTVHTVKKTYECKECGKSFSLRSS
LTGHKRIHTGEKPFKCKDCGKAFRFHSQLSVHKRIHTGEKSYECKECGKAFSCGSDLTRH
QRIHTGEKPYECNECRKAFSQRSHLIKHQRIHTGEKPYECKECGKAFTRGSHLTQHQRIH
TGEKSHECKECGKAFIRGSNLAQHQNVHVGRKPYKCEKCGKAYIWSSHLARHQRIHTGRK
PYECKQCGKTFTWASYLAQHEKIHNERKSYECKECGKTFLHGSEFNRHQKIHTGERNYEC
KECGKTFFRGSELNRHQKIHTGKRPYECEECGKAFLWGSQLTRHQRMHTGEEPYVCKECG
KSFIWGSQLTRHKKIHTDAEPYGCKKSSHIFSHHSYFTEQKIHNSANLCEWTDYGNTFSH
ESNFAQHQNIYTFEKSYEFKDFEKAFSSSSHFISLL
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggcccatttgatgatgttcagggatgtggctgtagatttctctcaggaggagtgggag
tgcctggacctggaacagagggatttatatagagatgtgatgttggagaactacagcaac
atggtctcactgggtttttgcatttatcagccagaagcgttctctttattggagaaaggg
aaagagccctggaagattttgagggatgagacaagaggaccttgcccagacatgcagtcg
aggtgtcagaccaagaagttattaccaaaaaatggcatttttgagagagaaatagcccaa
ttggaaataatgagaatttgtaaaaaccacagccttgactgtttatgttttagaggtgac
tgggaaggcaacactcagtttcaaacacttcaagataatcaagaggaatgcttcaagcag
gtgatacgcacctgtgaaaaaaggcccacttttaaccagcatacagtgtttaatctacac
cagagacttaatacaggagacaaactgaatgaatttaaagaactggggaaagcctttatt
tctggttcagatcatactcaacatcagttaattcacacaagtgagaaattctgtggagat
aaagaatgtgggaatacctttcttcctgattcagaagttattcaatatcagacagttcac
actgttaagaaaacatatgaatgtaaagaatgtgggaagtcttttagtttacgttcgagt
cttactggtcataagagaattcataccggtgagaaaccttttaaatgtaaggattgtggg
aaagcctttagatttcattcacaacttagtgtccataagcgaattcatactggtgagaaa
tcttatgaatgtaaggaatgtgggaaggcctttagttgtggctcagatcttactcgacat
cagagaattcatactggtgaaaaaccctatgaatgtaatgaatgtagaaaggcctttagt
cagcgatcacatcttattaaacatcagagaattcacactggtgaaaaaccttatgaatgt
aaggagtgtgggaaagcttttactcgtggatcacacctaactcagcatcagagaattcat
actggtgagaaatctcatgagtgtaaggaatgtggaaaagcctttattcgtggttcaaat
cttgctcaacatcagaatgttcatgttggtaggaaaccttataaatgtgagaaatgtggg
aaagcctatatttggagctcacaccttgctcgacatcagcgaattcatactggcaggaaa
ccttatgaatgtaagcaatgcgggaagacttttacttgggcttcgtatcttgctcaacat
gagaaaattcacaatgagaggaaatcctatgaatgtaaggaatgtggaaagacctttctt
catggctcagagtttaatcgacatcagaaaattcatactggtgagagaaactatgaatgt
aaggaatgtggaaagaccttttttcgtggttcagaacttaatcgacaccagaaaattcat
actggaaagaggccatatgaatgtgaagaatgtggaaaagcctttctctggggttcacaa
cttactcgacatcagagaatgcatactggtgaggaaccttacgtatgtaaagaatgtggg
aaatcttttatctggggttcacagcttacacgacataagaaaattcatactgatgcagaa
ccttatggatgcaagaaaagtagccacatctttagtcaccattcatattttactgaacaa
aaaattcataatagtgcaaatctctgtgaatggacagactatgggaacacctttagtcat
gagtcaaactttgctcaacaccagaatatttacacttttgagaaatcctatgaatttaaa
gattttgagaaagcattttcttcaagctctcacttcatttcactcttgtga

DBGET integrated database retrieval system