KEGG   Homo sapiens (human): 389114
Entry
389114            CDS       T01001                                 
Symbol
ZNF662
Name
(RefSeq) zinc finger protein 662
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    389114 (ZNF662)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    389114 (ZNF662)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    389114 (ZNF662)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 Zn-ribbon_8 zf_UBZ zf-C2H2_jaz zf-trcl zf-C2H2_11 zf-C2H2_8 zf-H2C2_5 zf-met
Other DBs
NCBI-GeneID: 389114
NCBI-ProteinID: NP_997287
HGNC: 31930
Ensembl: ENSG00000182983
UniProt: Q6ZS27
Position
3:42906142..42919334
AA seq 426 aa
MLENYGAVASLAAFPFPKPALISQLERGETPWCSVPRGALDGEAPRGISSGYPFLKPAGI
SHPEQVEEPLNLKLQGEGPSLICPEGVLKRKKEDFILKEEIIEEAQDLMVLSSGPQWCGS
QELWFGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLG
IHHKILNEQIFYICEECGKCFDQNEDFDQHQKTHNGEKVYGCKECGKAFSFRSHCIAHQR
IHSGVKPYECQECAKAFVWKSNLIRHQRIHTGEKPFECKECGKGFSQNTSLTQHQRIHTG
EKPYTCKECGKSFTRNPALLRHQRMHTGEKPYECKDCGKGFMWNSDLSQHQRVHTGDKPH
ECTDCGKSFFCKAHLIRHQRIHTGERPYKCNDCGKAFSQNSVLIKHQRRHARDKPYNCQI
SHLLEH
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgctggagaattatggggctgtggcttccctggcagcatttccatttcccaaaccggct
ctgatttcccagctggagcgaggggaaacaccctggtgctcggttcctcggggagctctg
gatggagaggccccaaggggcatctcctcaggatatccatttctaaagcctgctgggatt
tcccatcctgagcaggtggaagagccattaaacctgaaactgcaaggagagggtccaagc
ctgatttgtccggagggtgtgttgaagaggaagaaagaagattttattctgaaggaggaa
attattgaggaagcacaggacctcatggtcctatcaagtggaccccagtggtgtggatcc
caggaattatggtttgggaaaacctgtgaagagaaaagcaggttagggagatggcctggt
tacctcaatgggggacgtatggaaagttctacaaatgatattatagaagtgattgtcaag
gatgagatgatctcagtagaagagagttcagggaatactgatgtcaataacctccttggt
atacatcacaaaattctaaatgagcaaatattctatatatgtgaggaatgcggcaagtgt
tttgatcaaaatgaggactttgatcaacaccagaaaactcataatggagagaaggtctat
ggatgtaaggaatgtgggaaggctttcagttttcgatcacattgcattgcacatcagaga
attcacagtggggtgaaaccctatgaatgtcaagaatgtgctaaggcctttgtttggaag
tcaaacctgattcgtcaccagagaatacatactggagagaaaccctttgaatgtaaggaa
tgtgggaagggctttagtcagaacacaagccttacgcaacatcaacggatccacactggt
gagaaaccatacacatgtaaggaatgtgggaaaagctttactcgaaacccagcccttctt
cgacatcagagaatgcacactggggagaagccttacgaatgtaaggactgtgggaagggc
ttcatgtggaactcagatctttctcagcaccagagggtccacactggggacaagcctcat
gaatgtactgactgtgggaaaagcttcttttgcaaggcacatcttattcgacatcaaaga
atccatactggggaaagaccctataaatgtaatgactgtgggaaggccttcagtcagaat
tctgtcttaattaagcaccagaggcgccatgctagagacaaaccctataactgtcagatc
tctcaccttcttgaacattag

DBGET integrated database retrieval system