KEGG   Homo sapiens (human): 393
Entry
393               CDS       T01001                                 
Symbol
ARHGAP4, C1, RGC1, RhoGAP4, SrGAP4, p115
Name
(RefSeq) Rho GTPase activating protein 4
  KO
K20122  Rho GTPase-activating protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    393 (ARHGAP4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    393 (ARHGAP4)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    393 (ARHGAP4)
SSDB
Motif
Pfam: RhoGAP FCH SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 393
NCBI-ProteinID: NP_001657
OMIM: 300023
HGNC: 674
Ensembl: ENSG00000089820
Pharos: P98171(Tbio)
UniProt: P98171
Structure
Position
X:complement(153907378..153926264)
AA seq 946 aa
MAAHGKLRRERGLQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVE
LEYSRGLEKLAERFSSRGGRLGSSREHQSFRKEPSLLSPLHCWAVLLQHTRQQSRESAAL
SEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELLEVVSELQTAKKTYQAYHMESVN
AEAKLREAERQEEKRAGRSVPTTTAGATEAGPLRKSSLKKGGRLVEKRQAKFMEHKLKCT
KARNEYLLSLASVNAAVSNYYLHDVLDLMDCCDTGFHLALGQVLRSYTAAESRTQASQVQ
GLGSLEEAVEALDPPGDKAKVLEVHATVFCPPLRFDYHPHDGDEVAEICVEMELRDEILP
RAQNIQSRLDRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSD
PGSRQAGRRRGQQQETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSW
TQYTQRKFQKSRQPRPSSQYNQRLFGGDMEKFIQSSGQPVPLVVESCIRFINLNGLQHEG
IFRVSGAQLRVSEIRDAFERGEDPLVEGCTAHDLDSVAGVLKLYFRSLEPPLFPPDLFGE
LLASSELEATAERVEHVSRLLWRLPAPVLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCF
GPTLLPVPAGQDPVALQGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGD
AQLESLGADNEPELEAEMPAQEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERAS
SDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPC
TSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSP
SPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH
NT seq 2841 nt   +upstreamnt  +downstreamnt
atggccgctcacgggaagctgcggcgggagcgggggctgcaggctgagtatgagacgcaa
gtcaaagagatgcgctggcagctgagcgagcagctgcgctgcctggagctgcagggcgag
ctgcggcgggagttgctgcaggagctggcagagttcatgcggcgccgcgctgaggtggag
ctggaatactcccggggcctggaaaagctggccgagcgcttctccagccgtggaggccgc
ctggggagcagccgggagcaccaaagcttccggaaggagccgtccctcctgtcgcccttg
cactgctgggcggtgctgctgcagcacacgcggcagcagagccgggagagcgcggccctg
agtgaggtgctggccgggcccctggcccagcgcctgagtcacattgcagaggacgtgggg
cgcctggtcaagaagagcagggatctggagcagcagctgcaggatgagctcctggaggtg
gtctcagagctccagacggccaagaagacgtaccaggcatatcacatggagagcgtgaat
gccgaggccaagctccgggaggccgagcggcaggaggagaagcgggcaggccggagtgtc
cccaccaccaccgctggtgccactgaggcagggcccctccgcaagagctccctcaagaag
ggagggaggctggtggagaagcggcaggccaagttcatggagcacaaactcaagtgcaca
aaggcgcgcaacgagtacctgcttagcctggctagtgtcaacgctgctgtcagtaactac
tacctgcatgacgtcttggacctcatggactgctgtgacacagggttccacctggccctg
gggcaggtgctccggagctacacggccgctgagagccgcacccaagcctcccaagtgcag
ggcctgggcagcctggaagaagctgtggaggccctggatcctccaggggacaaagccaag
gttctcgaggtgcatgctaccgtcttctgtcccccgctgcgctttgactaccacccccat
gatggggatgaggtggctgagatctgcgttgaaatggagctgcgggacgagattctgccc
agagcccagaacatccagagccgcctggaccgacagaccattgagacagaggaggtgaac
aagactctgaaggcgacactgcaggccctgctggaggtggtggcctcggatgacggggat
gtgcttgattccttccagaccagcccctccaccgagtccctcaagtccaccagctcagac
ccaggcagccggcaggcgggccggaggcgcggccagcagcaggagaccgaaaccttctac
ctcacgaagctccaggagtatctgagtggacggagcatcctcgccaagctgcaggccaag
cacgagaagctgcaggaggcccttcagcgaggtgacaaggaggagcaggaggtgtcttgg
acccagtacacacagagaaaattccagaagagccgccagccccgccccagctcccagtat
aaccagagactctttgggggagacatggagaagtttatccagagctcaggccagcctgtg
cccctggtggtggagagctgcattcgcttcatcaacctcaatggcctgcagcatgaaggc
atcttccgggtatcgggtgcccagctccgggtctcagagatccgtgatgccttcgagaga
ggggaggacccactggtggagggctgcactgcccatgacctggactcggtggccggggtg
ctgaagctctacttccggagcctggagcccccactcttccccccagacctgttcggcgag
ctgctggcttcttcggagctggaggccacagcggagagggtggagcacgtgagccgcctg
ctgtggcggctgcccgcgccggtgctggtggttctgcgctacctcttcaccttcctcaac
cacctggcccagtacagcgatgagaacatgatggacccctacaacctggccgtgtgcttc
gggcccacgctgctaccggtgcccgctgggcaggacccggtggcgctgcagggccgggtg
aaccagctggtgcagacgctcatagtgcagcccgatcgggtcttcccgcccctgacctcg
ctgcctggccccgtctacgagaagtgcatggcaccgccttccgccagctgcctgggggac
gcccagctggagagcctgggggcggacaatgagccggagctggaagccgagatgcccgca
caggaggatgacctggagggggtcgtggaggctgtggcctgctttgcctacacgggccgc
acagcccaggagctgagcttccggcggggggacgtactgcggctgcacgagagggcctcg
agcgactggtggcggggggagcacaacggcatgcggggcctcatcccccacaagtatatc
acgctgcccgccgggacggagaagcaggtggtgggcgcagggctgcagactgcaggggag
tctgggagcagtcccgagggcctcctggcatcggagctggtccaccggccagagccatgc
acctcacctgaggccatgggaccctctggacacagacgacgctgcttggtcccagcctcc
ccagagcaacacgtggaggtggataaggctgtggcacagaacatggactctgtgtttaag
gagctcttgggaaagacctctgtccgccagggccttgggccagcatctaccacctctccc
agtcctgggccccgaagcccaaaggccccgcccagcagccgcctgggcaggaacaaaggc
ttctcccggggccctggggccccagcctcaccctcagcttcccacccccagggcctagac
acgacccccaagccacactga

DBGET integrated database retrieval system