KEGG   Homo sapiens (human): 3932Help
Entry
3932              CDS       T01001                                 

Gene name
LCK, IMD22, LSK, YT16, p56lck, pp58lck
Definition
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05340  Primary immunodeficiency
Network
N00511  HTLV-1 Tax to E47-mediated transcription
Disease
H00093  Combined immunodeficiency
Drug target
Dasatinib (DG00714): D03658 D06414
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    3932 (LCK)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3932 (LCK)
   04660 T cell receptor signaling pathway
    3932 (LCK)
   04658 Th1 and Th2 cell differentiation
    3932 (LCK)
   04659 Th17 cell differentiation
    3932 (LCK)
  09158 Development
   04380 Osteoclast differentiation
    3932 (LCK)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    3932 (LCK)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    3932 (LCK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3932 (LCK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3932 (LCK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3932 (LCK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   3932 (LCK)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    3932 (LCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 3932
NCBI-ProteinID: NP_001036236
OMIM: 153390
HGNC: 6524
Ensembl: ENSG00000182866
Vega: OTTHUMG00000007463
Pharos: P06239(Tclin)
UniProt: P06239 A0A0S2Z3Y8
Structure
PDB: 

Position
1p35.2
AA seq 509 aa AA seqDB search
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtggctgcagctcacacccggaagatgactggatggaaaacatcgatgtgtgt
gagaactgccattatcccatagtcccactggatggcaagggcacgctgctcatccgaaat
ggctctgaggtgcgggacccactggttacctacgaaggctccaatccgccggcttcccca
ctgcaagacaacctggttatcgctctgcacagctatgagccctctcacgacggagatctg
ggctttgagaagggggaacagctccgcatcctggagcagagcggcgagtggtggaaggcg
cagtccctgaccacgggccaggaaggcttcatccccttcaattttgtggccaaagcgaac
agcctggagcccgaaccctggttcttcaagaacctgagccgcaaggacgcggagcggcag
ctcctggcgcccgggaacactcacggctccttcctcatccgggagagcgagagcaccgcg
ggatcgttttcactgtcggtccgggacttcgaccagaaccagggagaggtggtgaaacat
tacaagatccgtaatctggacaacggtggcttctacatctcccctcgaatcacttttccc
ggcctgcatgaactggtccgccattacaccaatgcttcagatgggctgtgcacacggttg
agccgcccctgccagacccagaagccccagaagccgtggtgggaggacgagtgggaggtt
cccagggagacgctgaagctggtggagcggctgggggctggacagttcggggaggtgtgg
atggggtactacaacgggcacacgaaggtggcggtgaagagcctgaagcagggcagcatg
tccccggacgccttcctggccgaggccaacctcatgaagcagctgcaacaccagcggctg
gttcggctctacgctgtggtcacccaggagcccatctacatcatcactgaatacatggag
aatgggagtctagtggattttctcaagaccccttcaggcatcaagttgaccatcaacaaa
ctcctggacatggcagcccaaattgcagaaggcatggcattcattgaagagcggaattat
attcatcgtgaccttcgggctgccaacattctggtgtctgacaccctgagctgcaagatt
gcagactttggcctagcacgcctcattgaggacaacgagtacacagccagggagggggcc
aagtttcccattaagtggacagcgccagaagccattaactacgggacattcaccatcaag
tcagatgtgtggtcttttgggatcctgctgacggaaattgtcacccacggccgcatccct
tacccagggatgaccaacccggaggtgattcagaacctggagcgaggctaccgcatggtg
cgccctgacaactgtccagaggagctgtaccaactcatgaggctgtgctggaaggagcgc
ccagaggaccggcccacctttgactacctgcgcagtgtgctggaggacttcttcacggcc
acagagggccagtaccagcctcagccttga

DBGET integrated database retrieval system