KEGG   Homo sapiens (human): 394
Entry
394               CDS       T01001                                 
Symbol
ARHGAP5, GFI2, RhoGAP5, p190-B, p190BRhoGAP
Name
(RefSeq) Rho GTPase activating protein 5
  KO
K13709  Rho GTPase-activating protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    394 (ARHGAP5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    394 (ARHGAP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    394 (ARHGAP5)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    394 (ARHGAP5)
SSDB
Motif
Pfam: RhoGAP_pG1_pG2 RhoGAP RhoGAP-FF1 FF Ras GTP_EFTU NOG1 Roc MMR_HSR1 U5_2-snRNA_bdg
Other DBs
NCBI-GeneID: 394
NCBI-ProteinID: NP_001025226
OMIM: 602680
HGNC: 675
Ensembl: ENSG00000100852
Pharos: Q13017(Tbio)
UniProt: Q13017
Structure
Position
14:32075880..32159728
AA seq 1502 aa
MMAKNKEPRPPSYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAYKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPIPANKDLSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
IHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLA
HPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDR
TSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPL
LSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYF
GMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINL
VSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPV
NYDVFRYVITHLNRVSQQHKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVET
FIQQCQFFFYNGEIVETTNIVAPPPPSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPLG
II
NT seq 4509 nt   +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgtcccccatcctataccatcagtatagttggactc
tctgggactgaaaaagacaaaggtaactgtggagttggaaagtcttgtttgtgcaataga
tttgtacgctcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccatt
gactttggaggacgagtagtaaacaatgatcactttttgtactggggtgacataatacaa
aatagtgaagatggagtagaatgcaaaattcatgtcattgaacaaacagagttcattgat
gaccagactttcttgcctcatcggagtacgaatttgcaaccatatataaaacgtgcagct
gcatctaaattgcagtcagcagaaaaactaatgtacatttgcactgatcagctaggctta
gaacaagactttgaacagaagcaaatgcctgaagggaagctcaacgtagatggattttta
ttatgcattgatgtaagtcaaggatgcaataggaagtttgatgatcaacttaaatttgtg
aataacctttttgtccagttatcaaaatcaaaaaaacctgtaataatagcagcaactaaa
tgtgatgaatgcgtggatcattatcttagagaagttcaggcatttgcttcaaataaaaag
aaccttcttgtagtggaaacatcagcacgatttaatgtcaacattgaaacatgttttact
gcactggtacaaatgttggataaaactcgtagcaagcctaaaattattccctatttggat
gcttataaaacacagagacaacttgttgtcacagcaacagataagtttgaaaaacttgtg
cagactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatacatcaacttagagggaacaagaaaggccagaaatacattctca
aaacatatagaacaacttaaacaggaacatataagaaaaaggagagaagagtatataaat
actttaccaagagcttttaacactcttttgccaaatctagaagagattgaacatttgaat
tggtcagaagctttgaagttaatggaaaagagagcagatttccagttatgttttgtggtg
ctagaaaaaactccttgggatgaaactgaccatatagacaaaattaatgataggcggatt
ccatttgacctcctgagcactttagaagctgaaaaagtctatcagaaccatgtacagcat
ctgatatccgagaagaggagggtggaaatgaaggaaaaattcaaaaagactttggaaaaa
attcaattcatttcaccagggcagccatgggaggaagttatgtgctttgttatggaggat
gaagcctacaaatatatcactgaggctgatagcaaagaggtatatggtaggcatcagcga
gaaatagttgaaaaagccaaagaagagtttcaagaaatgctttttgagcattctgaactt
ttttatgatttagatcttaatgcaacacctagttcagataaaatgagtgaaattcataca
gttctgagtgaagaacctagatataaagctttacagaaacttgcacctgatagggaatcc
cttctacttaagcatataggatttgtttatcatcccactaaagaaacatgtcttagtggc
caaaattgtacagacattaaagtggagcagttacttgctagtagtcttttacagttggat
catggccgcttaagattatatcacgatagtaccaatatagataaagttaacctttttatt
ttagggaaggatggccttgcccaagaactagcaaatgagataaggacacaatccactgat
gatgagtatgccttagatggaaaaatttatgaacttgatcttcggccggttgatgccaaa
tcgccttactttttgagtcagttatggactgccgcctttaaaccacatgggtgcttctgt
gtatttaattccattgagtcattgagttttattggggaatttattgggaaaataagaact
gaagcttctcagatcagaaaagataaatacatggctaatcttccatttacattaattctg
gctaatcagagagattccattagtaagaatctaccaattctcaggcaccaagggcagcag
ttggcaaacaagttgcaatgtccttttgtagatgtacctgctggtacatatcctcgtaaa
tttaatgaaacccaaataaagcaagctctcagaggagtattggaatcagttaaacacaat
ttggatgtggtgagcccaattcctgccaataaggacttatcagaagctgacttgagaatt
gtcatgtgcgccatgtgtggagatccatttagtgtggatcttattctttcacccttcctt
gattctcattcttgcagtgctgctcaagctggacagaataattccctaatgcttgataaa
atcattggtgaaaaaaggaggcgaatacagatcacaatattatcataccactcttcaatt
ggagtaagaaaagatgaactagttcatgggtatatattagtttactctgcaaaacggaaa
gcttcgatgggaatgcttcgagcatttctatcagaagttcaagacaccattcctgtacag
ctggtggcagttactgacagccaagcagatttttttgaaaatgaggctatcaaagagtta
atgactgaaggagaacacattgcaactgagatcactgctaaatttacagcactgtattct
ttatctcagtatcatcggcaaactgaggtctttactctgttttttagtgatgttctagag
aaaaaaaatatgatagaaaattcttatttgtctgataatacaagggaatcaacccatcaa
agtgaagatgtttttctaccatctcccagagactgttttccctataataactaccctgat
tcagatgatgacacagaagcaccacctccttatagtccaattggggatgatgtacagttg
cttccaacacctagtgaccgttccagatatagattagatttggaaggaaatgagtatcct
attcatagtaccccaaactgtcatgaccatgaacgcaaccataaagtgcctccacctatt
aaacctaaaccagttgtacctaagacaaatgtgaaaaaactcgatccaaaccttttaaaa
acaattgaagctggtattggtaaaaatccaagaaagcagacttcccgggtgcctttggca
catcctgaagatatggatccttcagataactatgcggaacccattgatacaattttcaaa
cagaagggctattctgatgagatttatgttgtcccagatgatagtcaaaatcgtattaaa
attcgaaactcatttgtaaataacacccaaggagatgaagaaaatgggttttctgataga
acctcaaaaagtcatggggaacggaggccttcaaaatacaaatataaatctaaaaccttg
tttagtaaagccaagtcatactatagaagaacacattcagatgccagtgatgatgaggct
ttcaccacttctaaaacaaaaagaaaaggaagacatcgtggaagtgaagaagatccactt
ctttctcctgttgaaacttggaaaggtggtattgataatcctgcaatcacttctgaccag
gagttagatgataagaagatgaagaagaaaacccacaaagtgaaagaagataaaaagcag
aaaaagaaaactaagaacttcaatccaccaacacgtagaaattgggaaagtaattacttt
gggatgcccctccaggatctggttacagctgagaagcccataccactatttgttgagaaa
tgtgtggaatttattgaagatacagggttatgtaccgaaggactctaccgtgtcagcggg
aataaaactgaccaagacaatattcaaaagcagtttgatcaagatcataatatcaatcta
gtgtcaatggaagtaacagtaaatgctgtagctggagcccttaaagctttctttgcagat
ctgccagatcctttaattccatattctcttcatccagaactattggaagcagcaaaaatc
ccggataaaacagaacgtcttcatgccttgaaagaaattgttaagaaatttcatcctgta
aactatgatgtattcagatacgtgataacacatctaaacagggttagtcagcaacataaa
atcaacctaatgacagcagacaacttatccatctgtttttggccaaccttgatgagacct
gattttgaaaatcgagagtttctgtctactactaagattcatcaatctgttgttgaaaca
ttcattcagcagtgtcagtttttcttttacaatggagaaattgtagaaacgacaaacatt
gtggctcctccaccaccttcaaacccaggacagttggtggaaccaatggtgccacttcag
ttgccgccaccattgcaacctcagctgatacaaccacaattacaaacggatcctcttggt
attatatga

DBGET integrated database retrieval system