KEGG   Homo sapiens (human): 3973Help
Entry
3973              CDS       T01001                                 

Gene name
LHCGR, HHG, LCGR, LGR2, LH/CG-R, LH/CGR, LHR, LHRHR, LSH-R, ULG5
Definition
(RefSeq) luteinizing hormone/choriogonadotropin receptor
  KO
K04248  lutropin-choriogonadotropic hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04913  Ovarian steroidogenesis
hsa04917  Prolactin signaling pathway
Network
nt06323  KISS1-GnRH-LH-estrogen signaling
  Element
N00885  LHCGR-GNAS-PKA signaling pathway
N00886  Mutation-activated LHCGR to LHCGR-GNAS-PKA signaling pathway
Disease
H00608  46,XY disorder of sex development due to testosterone secretion defect
H00937  Precocious puberty
H02019  Familial male-limited precocious puberty
Drug target
Choriogonadotropin alfa: D03478
Chorionic gonadotrophin: D06457
Human menopausal gonadotrophin (DG00472): D02692 D06459
Lutropin alfa: D04824
Serum gonadotrophin: D05258
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3973 (LHCGR)
   04024 cAMP signaling pathway
    3973 (LHCGR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3973 (LHCGR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    3973 (LHCGR)
   04917 Prolactin signaling pathway
    3973 (LHCGR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3973 (LHCGR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Lutropin-choriogonadotropic hormone
    3973 (LHCGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 LRR_8 LRR_5 Comm
Motif
Other DBs
NCBI-GeneID: 3973
NCBI-ProteinID: NP_000224
OMIM: 152790
HGNC: 6585
Ensembl: ENSG00000138039
Vega: OTTHUMG00000129257
Pharos: P22888(Tclin)
UniProt: P22888
Position
2p16.3
AA seq 699 aa AA seqDB search
MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLP
VKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFI
NLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLK
LYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSY
GLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
SKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMGYD
FLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRL
RHAILIMLGGWLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFF
IICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLIT
VTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSAYT
SNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcggttctcggcgctgcagctgctgaagctgctgctgctgctgcagccgccg
ctgccacgagcgctgcgcgaggcgctctgccctgagccctgcaactgcgtgcccgacggc
gccctgcgctgccccggccccacggccggtctcactcgactatcacttgcctacctccct
gtcaaagtgatcccatctcaagctttcagaggacttaatgaggtcataaaaattgaaatc
tctcagattgattccctggaaaggatagaagctaatgcctttgacaacctcctcaatttg
tctgaaatactgatccagaacaccaaaaatctgagatacattgagcccggagcatttata
aatcttccccgattaaaatacttgagcatctgtaacacaggcatcagaaagtttccagat
gttacgaaggtcttctcctctgaatcaaatttcattctggaaatttgtgataacttacac
ataaccaccataccaggaaatgcttttcaagggatgaataatgaatctgtaacactcaaa
ctatatggaaatggatttgaagaagtacaaagtcatgcattcaatgggacgacactgact
tcactggagctaaaggaaaacgtacatctggagaagatgcacaatggagccttccgtggg
gccacagggccgaaaaccttggatatttcttccaccaaattgcaggccctgccgagctat
ggcctagagtccattcagaggctaattgccacgtcatcctattctctaaaaaaattgcca
tcaagagaaacatttgtcaatctcctggaggccacgttgacttaccccagccactgctgt
gcttttagaaacttgccaacaaaagaacagaatttttcacattccatttctgaaaacttt
tccaaacaatgtgaaagcacagtaaggaaagtgaataacaaaacactttattcttccatg
cttgctgagagtgaactgagtggctgggactatgaatatggtttctgcttacccaagaca
ccccgatgtgctcctgaaccagatgcttttaatccctgtgaagatattatgggctatgac
ttccttagggtcctgatttggctgattaatattctagccatcatgggaaacatgactgtt
ctttttgttctcctgacaagtcgttacaaacttacagtgcctcgttttctcatgtgcaat
ctctcctttgcagacttttgcatggggctctatctgctgctcatagcctcagttgattcc
caaaccaagggccagtactataaccatgccatagactggcagacagggagtgggtgcagc
actgctggctttttcactgtattcgcaagtgaactttctgtctacaccctcaccgtcatc
actctagaaagatggcacaccatcacctatgctattcacctggaccaaaagctgcgatta
agacatgccattctgattatgcttggaggatggctcttttcttctctaattgctatgttg
ccccttgtcggtgtcagcaattacatgaaggtcagtatttgcttccccatggatgtggaa
accactctctcacaagtctatatattaaccatcctgattctcaatgtggtggccttcttc
ataatttgtgcttgctacattaaaatttattttgcagttcgaaacccagaattaatggct
accaataaagatacaaagattgctaagaaaatggcaatcctcatcttcaccgatttcacc
tgcatggcacctatctctttttttgccatctcagctgccttcaaagtacctcttatcaca
gtaaccaactctaaagttttactggttcttttttatcccatcaattcttgtgccaatcca
tttctgtatgcaatattcactaagacattccaaagagatttctttcttttgctgagcaaa
tttggctgctgtaaacgtcgggctgaactttatagaaggaaagatttttcagcttacacc
tccaactgcaaaaatggcttcactggatcaaataagccttctcaatccaccttgaagttg
tccacattgcactgtcaaggtacagctctcctagacaagactcgctacacagagtgttaa

DBGET integrated database retrieval system