KEGG   Homo sapiens (human): 3973Help
Entry
3973              CDS       T01001                                 

Gene name
LHCGR, HHG, LCGR, LGR2, LH/CG-R, LH/CGR, LHR, LHRHR, LSH-R, ULG5
Definition
(RefSeq) luteinizing hormone/choriogonadotropin receptor
  KO
K04248  luteinizing hormone/choriogonadotropin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04913  Ovarian steroidogenesis
hsa04917  Prolactin signaling pathway
Disease
H00608  46,XY disorder of sex development due to testosterone secretion defect
H00627  Premature ovarian failure
H00937  Precocious puberty
H02019  Familial male-limited precocious puberty
Drug target
Choriogonadotropin alfa: D03478
Chorionic gonadotrophin: D06457
Human menopausal gonadotrophin (DG00472): D02692 D06459
Lutropin alfa: D04824
Serum gonadotrophin: D05258
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3973 (LHCGR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3973 (LHCGR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    3973 (LHCGR)
   04917 Prolactin signaling pathway
    3973 (LHCGR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3973 (LHCGR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Lutropin-choriogonadotropic hormone
    3973 (LHCGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 LRR_8 LRR_5 Comm
Motif
Other DBs
NCBI-GeneID: 3973
NCBI-ProteinID: NP_000224
OMIM: 152790
HGNC: 6585
Ensembl: ENSG00000138039
Vega: OTTHUMG00000129257
Pharos: P22888(Tclin)
UniProt: P22888
Position
2p16.3
AA seq 699 aa AA seqDB search
MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLP
VKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFI
NLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLK
LYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSY
GLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
SKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMGYD
FLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRL
RHAILIMLGGWLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFF
IICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLIT
VTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSAYT
SNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcggttctcggcgctgcagctgctgaagctgctgctgctgctgcagccgccg
ctgccacgagcgctgcgcgaggcgctctgccctgagccctgcaactgcgtgcccgacggc
gccctgcgctgccccggccccacggccggtctcactcgactatcacttgcctacctccct
gtcaaagtgatcccatctcaagctttcagaggacttaatgaggtcataaaaattgaaatc
tctcagattgattccctggaaaggatagaagctaatgcctttgacaacctcctcaatttg
tctgaaatactgatccagaacaccaaaaatctgagatacattgagcccggagcatttata
aatcttccccgattaaaatacttgagcatctgtaacacaggcatcagaaagtttccagat
gttacgaaggtcttctcctctgaatcaaatttcattctggaaatttgtgataacttacac
ataaccaccataccaggaaatgcttttcaagggatgaataatgaatctgtaacactcaaa
ctatatggaaatggatttgaagaagtacaaagtcatgcattcaatgggacgacactgact
tcactggagctaaaggaaaacgtacatctggagaagatgcacaatggagccttccgtggg
gccacagggccgaaaaccttggatatttcttccaccaaattgcaggccctgccgagctat
ggcctagagtccattcagaggctaattgccacgtcatcctattctctaaaaaaattgcca
tcaagagaaacatttgtcaatctcctggaggccacgttgacttaccccagccactgctgt
gcttttagaaacttgccaacaaaagaacagaatttttcacattccatttctgaaaacttt
tccaaacaatgtgaaagcacagtaaggaaagtgaataacaaaacactttattcttccatg
cttgctgagagtgaactgagtggctgggactatgaatatggtttctgcttacccaagaca
ccccgatgtgctcctgaaccagatgcttttaatccctgtgaagatattatgggctatgac
ttccttagggtcctgatttggctgattaatattctagccatcatgggaaacatgactgtt
ctttttgttctcctgacaagtcgttacaaacttacagtgcctcgttttctcatgtgcaat
ctctcctttgcagacttttgcatggggctctatctgctgctcatagcctcagttgattcc
caaaccaagggccagtactataaccatgccatagactggcagacagggagtgggtgcagc
actgctggctttttcactgtattcgcaagtgaactttctgtctacaccctcaccgtcatc
actctagaaagatggcacaccatcacctatgctattcacctggaccaaaagctgcgatta
agacatgccattctgattatgcttggaggatggctcttttcttctctaattgctatgttg
ccccttgtcggtgtcagcaattacatgaaggtcagtatttgcttccccatggatgtggaa
accactctctcacaagtctatatattaaccatcctgattctcaatgtggtggccttcttc
ataatttgtgcttgctacattaaaatttattttgcagttcgaaacccagaattaatggct
accaataaagatacaaagattgctaagaaaatggcaatcctcatcttcaccgatttcacc
tgcatggcacctatctctttttttgccatctcagctgccttcaaagtacctcttatcaca
gtaaccaactctaaagttttactggttcttttttatcccatcaattcttgtgccaatcca
tttctgtatgcaatattcactaagacattccaaagagatttctttcttttgctgagcaaa
tttggctgctgtaaacgtcgggctgaactttatagaaggaaagatttttcagcttacacc
tccaactgcaaaaatggcttcactggatcaaataagccttctcaatccaccttgaagttg
tccacattgcactgtcaaggtacagctctcctagacaagactcgctacacagagtgttaa

DBGET integrated database retrieval system