KEGG   Homo sapiens (human): 3977Help
Entry
3977              CDS       T01001                                 

Gene name
LIFR, CD118, LIF-R, SJS2, STWS, SWS
Definition
(RefSeq) LIF receptor alpha
  KO
K05058  leukemia inhibitory factor receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  Jak-STAT signaling pathway
Disease
H00462  Stuve-Wiedemann syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3977 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3977 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3977 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3977 (LIFR)
   04090 CD Molecules [BR:hsa04090]
    3977 (LIFR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   3977 (LIFR)
CD molecules [BR:hsa04090]
 Proteins
  3977 (LIFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind DUF3827 MotB_plug
Motif
Other DBs
NCBI-GeneID: 3977
NCBI-ProteinID: NP_001121143
OMIM: 151443
HGNC: 6597
Ensembl: ENSG00000113594
Vega: OTTHUMG00000131138
Pharos: P42702(Tbio)
UniProt: P42702 A8K1Z4
Structure
PDB: 

Position
5p13.1
AA seq 1097 aa AA seqDB search
MMDIYVCLKRPSWMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPHDLKCVTNNL
QVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGS
STSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKE
SMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGLEEWSDWSP
VKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIHLDGENVAIK
IRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEIICSWNPGRVTA
LVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQLLFQMLPNQEIYNFTLNAHNPLGRSQ
STILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCEIEIKKSNSVQEQR
NVTIKGVENSSYLVALDKLNPYTLYTFRIRCSTETFWKWSKWSNKKQHLTTEASPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIRLDK
NDYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGILLTWHYDPNMTCDYVIK
WCNSSRSEPCLMDWRKVPSNSTETVIESDEFRPGIRYNFFLYGCRNQGYQLLRSMIGYIE
ELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGR
SDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENSVGLIIAI
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEM
NPCTPNNVEVLETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPN
PAADEAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDIAAEE
DLDKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKS
NGGGWSFTNFFQNKPND
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgatggatatttacgtatgtttgaaacgaccatcctggatggtggacaataaaagaatg
aggactgcttcaaatttccagtggctgttatcaacatttattcttctatatctaatgaat
caagtaaatagccagaaaaagggggctcctcatgatttgaagtgtgtaactaacaatttg
caagtgtggaactgttcttggaaagcaccctctggaacaggccgtggtactgattatgaa
gtttgcattgaaaacaggtcccgttcttgttatcagttggagaaaaccagtattaaaatt
ccagctctttcacatggtgattatgaaataacaataaattctctacatgattttggaagt
tctacaagtaaattcacactaaatgaacaaaacgtttccttaattccagatactccagag
atcttgaatttgtctgctgatttctcaacctctacattatacctaaagtggaacgacagg
ggttcagtttttccacaccgctcaaatgttatctgggaaattaaagttctacgtaaagag
agtatggagctcgtaaaattagtgacccacaacacaactctgaatggcaaagatacactt
catcactggagttgggcctcagatatgcccttggaatgtgccattcattttgtggaaatt
agatgctacattgacaatcttcatttttctggtctcgaagagtggagtgactggagccct
gtgaagaacatttcttggatacctgattctcagactaaggtttttcctcaagataaagtg
atacttgtaggctcagacataacattttgttgtgtgagtcaagaaaaagtgttatcagca
ctgattggccatacaaactgccccttgatccatcttgatggggaaaatgttgcaatcaag
attcgtaatatttctgtttctgcaagtagtggaacaaatgtagtttttacaaccgaagat
aacatatttggaaccgttatttttgctggatatccaccagatactcctcaacaactgaat
tgtgagacacatgatttaaaagaaattatatgtagttggaatccaggaagggtgacagcg
ttggtgggcccacgtgctacaagctacactttagttgaaagtttttcaggaaaatatgtt
agacttaaaagagctgaagcacctacaaacgaaagctatcaattattatttcaaatgctt
ccaaatcaagaaatatataattttactttgaatgctcacaatccgctgggtcgatcacaa
tcaacaattttagttaatataactgaaaaagtttatccccatactcctacttcattcaaa
gtgaaggatattaattcaacagctgttaaactttcttggcatttaccaggcaactttgca
aagattaattttttatgtgaaattgaaattaagaaatctaattcagtacaagagcagcgg
aatgtcacaatcaaaggagtagaaaattcaagttatcttgttgctctggacaagttaaat
ccatacactctatatacttttcggattcgttgttctactgaaactttctggaaatggagc
aaatggagcaataaaaaacaacatttaacaacagaagccagtccttcaaaggggcctgat
acttggagagagtggagttctgatggaaaaaatttaataatctattggaagcctttaccc
attaatgaagctaatggaaaaatactttcctacaatgtatcgtgttcatcagatgaggaa
acacagtccctttctgaaatccctgatcctcagcacaaagcagagatacgacttgataag
aatgactacatcatcagcgtagtggctaaaaattctgtgggctcatcaccaccttccaaa
atagcgagtatggaaattccaaatgatgatctcaaaatagaacaagttgttgggatggga
aaggggattctcctcacctggcattacgaccccaacatgacttgcgactacgtcattaag
tggtgtaactcgtctcggtcggaaccatgccttatggactggagaaaagttccctcaaac
agcactgaaactgtaatagaatctgatgagtttcgaccaggtataagatataattttttc
ctgtatggatgcagaaatcaaggatatcaattattacgctccatgattggatatatagaa
gaattggctcccattgttgcaccaaattttactgttgaggatacttctgcagattcgata
ttagtaaaatgggaagacattcctgtggaagaacttagaggctttttaagaggatatttg
ttttactttggaaaaggagaaagagacacatctaagatgagggttttagaatcaggtcgt
tctgacataaaagttaagaatattactgacatatcccagaagacactgagaattgctgat
cttcaaggtaaaacaagttaccacctggtcttgcgagcctatacagatggtggagtgggc
ccggagaagagtatgtatgtggtgacaaaggaaaattctgtgggattaattattgccatt
ctcatcccagtggcagtggctgtcattgttggagtggtgacaagtatcctttgctatcgg
aaacgagaatggattaaagaaaccttctaccctgatattccaaatccagaaaactgtaaa
gcattacagtttcaaaagagtgtctgtgagggaagcagtgctcttaaaacattggaaatg
aatccttgtaccccaaataatgttgaggttctggaaactcgatcagcatttcctaaaata
gaagatacagaaataatttccccagtagctgagcgtcctgaagatcgctctgatgcagag
cctgaaaaccatgtggttgtgtcctattgtccacccatcattgaggaagaaataccaaac
ccagccgcagatgaagctggagggactgcacaggttatttacattgatgttcagtcgatg
tatcagcctcaagcaaaaccagaagaagaacaagaaaatgaccctgtaggaggggcaggc
tataagccacagatgcacctccccattaattctactgtggaagatatagctgcagaagag
gacttagataaaactgcgggttacagacctcaggccaatgtaaatacatggaatttagtg
tctccagactctcctagatccatagacagcaacagtgagattgtctcatttggaagtcca
tgctccattaattcccgacaatttttgattcctcctaaagatgaagactctcctaaatct
aatggaggagggtggtcctttacaaacttttttcagaacaaaccaaacgattaa

DBGET integrated database retrieval system