KEGG   Homo sapiens (human): 3991Help
Entry
3991              CDS       T01001                                 

Gene name
LIPE, AOMS4, FPLD6, HSL, LHS
Definition
(RefSeq) lipase E, hormone sensitive type
  KO
K07188  hormone-sensitive lipase [EC:3.1.1.79]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04152  AMPK signaling pathway
hsa04371  Apelin signaling pathway
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
Disease
H00420  Familial partial lipodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    3991 (LIPE)
   04024 cAMP signaling pathway
    3991 (LIPE)
   04152 AMPK signaling pathway
    3991 (LIPE)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    3991 (LIPE)
   04923 Regulation of lipolysis in adipocytes
    3991 (LIPE)
   04925 Aldosterone synthesis and secretion
    3991 (LIPE)
  09159 Environmental adaptation
   04714 Thermogenesis
    3991 (LIPE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     3991 (LIPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSL_N Abhydrolase_3 Say1_Mug180 PRP4
Motif
Other DBs
NCBI-GeneID: 3991
NCBI-ProteinID: NP_005348
OMIM: 151750
HGNC: 6621
Ensembl: ENSG00000079435
Vega: OTTHUMG00000182814
Pharos: Q05469(Tchem)
UniProt: Q05469 A8K8W7
Position
19q13.2
AA seq 1076 aa AA seqDB search
MEPGSKSVSRSDWQPEPHQRPITPLEPGPEKTPIAQPESKTLQGSNTQQKPASNQRPLTQ
QETPAQHDAESQKEPRAQQKSASQEEFLAPQKPAPQQSPYIQRVLLTQQEAASQQGPGLG
KESITQQEPALRQRHVAQPGPGPGEPPPAQQEAESTPAAQAKPGAKREPSAPTESTSQET
PEQSDKQTTPVQGAKSKQGSLTELGFLTKLQELSIQRSALEWKALSEWVTDSESESDVGS
SSDTDSPATMGGMVAQGVKLGFKGKSGYKVMSGYSGTSPHEKTSARNHRHYQDTASRLIH
NMDLRTMTQSLVTLAEDNIAFFSSQGPGETAQRLSGVFAGVREQALGLEPALGRLLGVAH
LFDLDPETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALT
QLRALVYYAQRLLVTNRPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRP
FLQTISIGLVSFGEHYKRNETGLSVAASSLFTSGRFAIDPELRGAEFERITQNLDVHFWK
AFWNITEMEVLSSLANMASATVRVSRLLSLPPEAFEMPLTADPTLTVTISPPLAHTGPGP
VLVRLISYDLREGQDSEELSSLIKSNGQRSLELWPRPQQAPRSRSLIVHFHGGGFVAQTS
RSHEPYLKSWAQELGAPIISIDYSLAPEAPFPRALEECFFAYCWAIKHCALLGSTGERIC
LAGDSAGGNLCFTVALRAAAYGVRVPDGIMAAYPATMLQPAASPSRLLSLMDPLLPLSVL
SKCVSAYAGAKTEDHSNSDQKALGMMGLVRRDTALLLRDFRLGASSWLNSFLELSGRKSQ
KMSEPIAEPMRRSVSEAALAQPQGPLGTDSLKNLTLRDLSLRGNSETSSDTPEMSLSAET
LSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLY
SSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDSVMLARRLRNLGQPVTLRVVE
DLPHGFLTLAALCRETRQAAELCVERIRLVLTPPAGAGPSGETGAAGVDGGCGGRH
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggagccaggttctaagtcagtgtctaggtcagactggcaacctgaaccacaccagagg
cctataaccccgctagagcctgggccagaaaagacacccatagcccagccagaatcgaag
actctgcagggatccaatacccaacagaagcctgcttcaaaccaaagacccctcacccag
caggagacccctgcacaacatgatgctgaatcccagaaggaacctagagcccaacaaaaa
tctgcttcacaagaggaatttcttgccccacagaagcccgcaccacagcaatcaccttac
atccaaagggtgctgctcactcaacaggaagctgcctcccagcagggacctgggctagga
aaagaatctataactcaacaggagccagcattgagacaaagacatgtagcccagccaggg
cctgggccaggagagccacctccagctcaacaagaagctgaatcaacacctgcggcccag
gctaaacctggagccaaaagggagccatctgccccgactgaatctacgtcccaagagaca
cctgaacagtcagacaagcaaacaacgccagtccagggagccaaatccaagcagggatct
ttgacagagctgggatttctaacaaaacttcaggaactatccatacagcgatcagcccta
gagtggaaggcactttctgagtgggtcacagattctgagtcagaatcagatgtgggatca
tcttcagacacagattctccagccacgatgggtggaatggtggcccagggagtgaagcta
ggcttcaaaggaaaatctggttataaagtgatgtcaggatacagtgggacgtcgccacat
gagaaaaccagtgctcggaatcacagacactaccaggatacagcctcaaggctcatccac
aacatggacctgcgcacaatgacacagtcgctggtgactctggcggaggacaacatagcc
ttcttctcgagccagggtcctggggaaacggcccagcggctgtcaggcgtttttgccggt
gtacgggagcaggcgctggggctggagccggccctgggccgcctgctgggtgtggcgcac
ctctttgacctggacccagagacaccggccaacgggtaccgcagcctagtgcacacagcc
cgctgctgcctggcgcacctcctgcacaaatcccgctatgtggcctccaaccgccgcagc
atcttcttccgcaccagccacaacctggccgagctggaggcctacctggctgccctcacc
cagctccgcgctctggtctactacgcccagcgcctgctggttaccaatcggccgggggta
ctcttctttgagggcgacgaggggctcaccgccgacttcctccgggagtatgtcacgctg
cataagggatgcttctatggccgctgcctgggcttccagttcacgcctgccatccggcca
ttcctgcagaccatctccattgggctggtgtccttcggggagcactacaaacgcaacgag
acaggcctcagtgtggccgccagctctctcttcaccagcggccgctttgccatcgacccc
gagctgcgtggggctgagtttgagcggatcacacagaacctggacgtgcacttctggaaa
gccttctggaacatcaccgagatggaagtgctatcgtctctggccaacatggcatcggcc
accgtgagggtaagccgcctgctcagcctgccacccgaagcctttgagatgccactgact
gccgaccccacgctcacggtcaccatctcacccccactggcccacacaggccctgggccc
gtcctcgtcaggctcatctcctatgacctgcgtgaaggacaggacagtgaggagctcagc
agcctgataaagtccaacggccaacggagcctggagctgtggccgcgcccccagcaggca
ccccgctcgcggtccctgatagtgcacttccacggcggtggctttgtggcccagacctcc
agatcccacgagccctacctcaagagctgggcccaggagctgggcgcccccatcatctcc
atcgactactccctggcccctgaggcccccttcccccgtgcgctggaggagtgcttcttc
gcctactgctgggccatcaagcactgcgccctccttggctcaacaggggaacgaatctgc
cttgcgggggacagtgcaggcgggaacctctgcttcaccgtggctcttcgggcagcagcc
tacggggtgcgggtgccagatggcatcatggcagcctacccggccacaatgctgcagcct
gccgcctctccctcccgcctgctgagcctcatggaccccttgctgcccctcagtgtgctc
tccaagtgtgtcagcgcctatgctggtgcaaagacggaggaccactccaactcagaccag
aaagccctcggcatgatggggctggtgcggcgggacacagccctgctcctccgagacttc
cgcctgggtgcctcctcatggctcaactccttcctggagttaagtgggcgcaagtcccag
aagatgtcggagcccatagcagagccgatgcgccgcagtgtgtctgaagcagcactggcc
cagccccagggcccactgggcacggattccctcaagaacctgaccctgagggacttgagc
ctgaggggaaactccgagacgtcgtcggacacccccgagatgtcgctgtcagctgagaca
cttagcccctccacaccctccgatgtcaacttcttattaccacctgaggatgcaggggaa
gaggctgaggccaaaaatgagctgagccccatggacagaggcctgggcgtccgtgccgcc
ttccccgagggtttccacccccgacgctccagccagggtgccacacagatgcccctctac
tcctcacccatagtcaagaaccccttcatgtcgccgctgctggcacccgacagcatgctc
aagagcctgccacctgtgcacatcgtggcgtgcgcgctggaccccatgctggacgactcg
gtcatgctcgcgcggcgactgcgcaacctgggccagccggtgacgctgcgcgtggtggag
gacctgccgcacggcttcctgaccctagcggcgctgtgccgcgagacgcgccaggccgca
gagctgtgcgtggagcgcatccgcctcgtcctcactcctcccgccggagccgggccgagc
ggggagacgggggctgcgggggtagacgggggctgcggggggcgacactaa

DBGET integrated database retrieval system