KEGG   Homo sapiens (human): 401036
Entry
401036            CDS       T01001                                 

Gene name
ASB18, ASB-18
Definition
(RefSeq) ankyrin repeat and SOCS box containing 18
  KO
K10340  ankyrin repeat and SOCS box protein 18
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    401036 (ASB18)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     401036 (ASB18)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 SOCS_box
Other DBs
NCBI-GeneID: 401036
NCBI-ProteinID: NP_997721
HGNC: 19770
Ensembl: ENSG00000182177
Vega: OTTHUMG00000153086
Pharos: Q6ZVZ8(Tdark)
UniProt: Q6ZVZ8
Position
2q37.2
AA seq 466 aa
MSNSDYLPDYPLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSA
QLPTGMLLGDLDHLKPLMDQFFQDANVVFEINKDEMEWQVKSPATFGLSGLWTLEYKREL
TTPLCIAAAHGHTACVRHLLGRGADPDASPGGRGALHEACLGGHTACVRLLLQHRADPDL
LSAEGLAPLHLCRTAASLGCAQALLEHGASVQRVGGTGRDTPLHVAAQRGLDEHARLYLG
RGAHVDARNGRGETALSAACGAARRPDEHGRCLRLCALLLRRGAEADARDEDERSPLHKA
CGHASHSLARLLLRHGADAGALDYGGASPLGRVLQTASCALQASPQRTVQALLNHGSPTV
WPDAFPKVLKTCASVPAVIEVLFNSYPQLCLSESWKEVIPEEVFQMHKPFYQSLFALALT
PRCLQHLCRCALRRLFGKRCFDLIPLLPLPKPLQNYLLLEPQGVLH
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgtccaactcggattaccttcccgactacccactcaactcagatttagtgaagagatta
aagtctgccctggatgccaaagatgaggagagagtgagggatttaatctgcactgaaatc
acgcctgtggacgctgtgatagaactggccaatgacgactggatgaaagacccctcggct
cagctgcccaccggcatgctgctaggggacctcgaccatctgaagcccctcatggaccag
ttcttccaggatgccaacgtggtgtttgagatcaataaggatgagatggaatggcaggtg
aaatctccagccacgtttggactatcaggcctctggaccctggagtacaagcgtgagctc
accacgcccctgtgcatcgccgcggcccacggccacaccgcctgcgtgcgacacctgctc
ggccgcggcgcagacccagacgccagccccggcggccgcggcgccctgcacgaggcctgc
ctcgggggccacaccgcctgcgtccgcctgctgctgcagcaccgcgccgaccccgacctg
ctcagcgccgagggcctggcgcctctgcacctctgccgcacggccgcctcgctcgggtgc
gcgcaggcgctgctggagcacggggcctcggtgcagcgcgtgggcggcacgggccgggac
acgccgctgcacgtggcggcgcagcgcggcctggacgagcacgcgcgcctgtacctgggc
cgcggggcgcacgtggacgcgaggaacggccgcggagagacggctctgagcgcggcctgc
ggtgcggcgcggaggcccgacgagcacgggcgctgcctgcgcctgtgcgcgctgctgctg
cggcgcggggcggaggcggacgcgcgcgacgaggacgagcgcagcccgctgcacaaagcc
tgcggccacgcgagccacagcctggcgcgcctcctactgcggcacggcgccgacgcgggc
gcgctcgactatggcggggcctcgccgctgggccgcgtgctccagaccgcatcctgcgct
ctccaggcctcaccgcagcgcacggtgcaggcgctgctcaaccacggctctcccaccgtg
tggcccgacgccttccccaaggtgctgaagacctgtgcatctgtccccgcagtcatcgag
gtgcttttcaactcctaccctcagctctgcttgtcagagtcctggaaggaagtgattcct
gaggaagtattccagatgcacaagccgttctaccagtccctctttgccttggccctcacc
ccacgctgcctgcagcatctttgccgctgtgctcttcgcagactgtttggcaaaaggtgc
tttgacctcatccccctgttacccttgccaaagcccctgcagaattacctacttttggag
ccacagggtgttttgcactga

DBGET integrated database retrieval system