KEGG   Homo sapiens (human): 4017
Entry
4017              CDS       T01001                                 

Gene name
LOXL2, LOR, LOR2, WS9-14
Definition
(RefSeq) lysyl oxidase like 2
  KO
K00280  lysyl oxidase-like protein 2/3/4 [EC:1.4.3.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4017 (LOXL2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     4017 (LOXL2)
SSDB
Motif
Pfam: Lysyl_oxidase SRCR SRCR_2 Hepsin-SRCR Exonuc_X-T_C
Other DBs
NCBI-GeneID: 4017
NCBI-ProteinID: NP_002309
OMIM: 606663
HGNC: 6666
Ensembl: ENSG00000134013
Vega: OTTHUMG00000163797
Pharos: Q9Y4K0(Tbio)
UniProt: Q9Y4K0
Structure
PDB: 
5ZE3

Position
8p21.3
AA seq 774 aa
MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRL
AGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLN
IQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGER
TYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVS
CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSA
SVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA
GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQL
GLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAG
VACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFS
SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLED
TECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEV
AESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggagaggcctctgtgctcccacctctgcagctgcctggctatgctggccctcctgtcc
cccctgagcctggcacagtatgacagctggccccattaccccgagtacttccagcaaccg
gctcctgagtatcaccagccccaggcccccgccaacgtggccaagattcagctgcgcctg
gctgggcagaagaggaagcacagcgagggccgggtggaggtgtactatgatggccagtgg
ggcaccgtgtgcgatgacgacttctccatccacgctgcccacgtcgtctgccgggagctg
ggctacgtggaggccaagtcctggactgccagctcctcctacggcaagggagaagggccc
atctggttagacaatctccactgtactggcaacgaggcgacccttgcagcatgcacctcc
aatggctggggcgtcactgactgcaagcacacggaggatgtcggtgtggtgtgcagcgac
aaaaggattcctgggttcaaatttgacaattcgttgatcaaccagatagagaacctgaat
atccaggtggaggacattcggattcgagccatcctctcaacctaccgcaagcgcacccca
gtgatggagggctacgtggaggtgaaggagggcaagacctggaagcagatctgtgacaag
cactggacggccaagaattcccgcgtggtctgcggcatgtttggcttccctggggagagg
acatacaataccaaagtgtacaaaatgtttgcctcacggaggaagcagcgctactggcca
ttctccatggactgcaccggcacagaggcccacatctccagctgcaagctgggcccccag
gtgtcactggaccccatgaagaatgtcacctgcgagaatgggctaccggccgtggtgagt
tgtgtgcctgggcaggtcttcagccctgacggaccctcaagattccggaaagcgtacaag
ccagagcaacccctggtgcgactgagaggcggtgcctacatcggggagggccgcgtggag
gtgctcaaaaatggagaatgggggaccgtctgcgacgacaagtgggacctggtgtcggcc
agtgtggtctgcagagagctgggctttgggagtgccaaagaggcagtcactggctcccga
ctggggcaagggatcggacccatccacctcaacgagatccagtgcacaggcaatgagaag
tccattatagactgcaagttcaatgccgagtctcagggctgcaaccacgaggaggatgct
ggtgtgagatgcaacacccctgccatgggcttgcagaagaagctgcgcctgaacggcggc
cgcaatccctacgagggccgagtggaggtgctggtggagagaaacgggtcccttgtgtgg
gggatggtgtgtggccaaaactggggcatcgtggaggccatggtggtctgccgccagctg
ggcctgggattcgccagcaacgccttccaggagacctggtattggcacggagatgtcaac
agcaacaaagtggtcatgagtggagtgaagtgctcgggaacggagctgtccctggcgcac
tgccgccacgacggggaggacgtggcctgcccccagggcggagtgcagtacggggccgga
gttgcctgctcagaaaccgcccctgacctggtcctcaatgcggagatggtgcagcagacc
acctacctggaggaccggcccatgttcatgctgcagtgtgccatggaggagaactgcctc
tcggcctcagccgcgcagaccgaccccaccacgggctaccgccggctcctgcgcttctcc
tcccagatccacaacaatggccagtccgacttccggcccaagaacggccgccacgcgtgg
atctggcacgactgtcacaggcactaccacagcatggaggtgttcacccactatgacctg
ctgaacctcaatggcaccaaggtggcagagggccacaaggccagcttctgcttggaggac
acagaatgtgaaggagacatccagaagaattacgagtgtgccaacttcggcgatcagggc
atcaccatgggctgctgggacatgtaccgccatgacatcgactgccagtgggttgacatc
actgacgtgccccctggagactacctgttccaggttgttattaaccccaacttcgaggtt
gcagaatccgattactccaacaacatcatgaaatgcaggagccgctatgacggccaccgc
atctggatgtacaactgccacataggtggttccttcagcgaagagacggaaaaaaagttt
gagcacttcagcgggctcttaaacaaccagctgtccccgcagtaa

DBGET integrated database retrieval system