KEGG   Homo sapiens (human): 404672Help
Entry
404672            CDS       T01001                                 

Gene name
GTF2H5, C6orf175, TFB5, TFIIH, TGF2H5, TTD, TTD-A, TTD3, TTDA, bA120J8.2
Definition
(RefSeq) general transcription factor IIH subunit 5
  KO
K10845  TFIIH basal transcription factor complex TTD-A subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
Module
hsa_M00290  Holo-TFIIH complex
Disease
H00403  Disorders of nucleotide excision repair
H00866  Trichothiodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    404672 (GTF2H5)
  09124 Replication and repair
   03420 Nucleotide excision repair
    404672 (GTF2H5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    404672 (GTF2H5)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    404672 (GTF2H5)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     404672 (GTF2H5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     404672 (GTF2H5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb5
Motif
Other DBs
NCBI-GeneID: 404672
NCBI-ProteinID: NP_997001
OMIM: 608780
HGNC: 21157
Ensembl: ENSG00000272047
Vega: OTTHUMG00000015906
Pharos: Q6ZYL4(Tbio)
UniProt: Q6ZYL4
Structure
PDB: 

Position
6q25.3
AA seq 71 aa AA seqDB search
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL
MDQNAFSLTQK
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgtcttgaaaggagtgcttatagaatgtgatcctgccatgaagcagtttctg
ctgtacttggatgagtccaatgccctggggaagaagttcatcattcaagacattgatgac
actcacgtctttgtaatagcagaattggttaatgtcctccaggagcgagtgggtgaatta
atggaccaaaatgctttttcccttacccagaaatga

DBGET integrated database retrieval system