KEGG   Homo sapiens (human): 4051
Entry
4051              CDS       T01001                                 

Symbol
CYP4F3, CPF3, CYP4F, CYPIVF3, LTB4H
Name
(RefSeq) cytochrome P450 family 4 subfamily F member 3
  KO
K17726  phylloquinone omega-hydroxylase / docosahexaenoic acid omega-hydroxylase / leukotriene-B4 20-monooxygenase [EC:1.14.14.78 1.14.14.79 1.14.14.94]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    4051 (CYP4F3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    4051 (CYP4F3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.78  phylloquinone omega-hydroxylase
     4051 (CYP4F3)
    1.14.14.79  docosahexaenoic acid omega-hydroxylase
     4051 (CYP4F3)
    1.14.14.94  leukotriene-B4 20-monooxygenase
     4051 (CYP4F3)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   4051 (CYP4F3)
SSDB
Motif
Pfam: p450 TetR_C_28 Diacid_rec
Other DBs
NCBI-GeneID: 4051
NCBI-ProteinID: NP_000887
OMIM: 601270
HGNC: 2646
Ensembl: ENSG00000186529
Vega: OTTHUMG00000182374
Pharos: Q08477(Tbio)
UniProt: Q08477 A0A024R7J8
Position
19p13.12
AA seq 520 aa
MPQLSLSSLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWF
LGHLGLIHSSEEGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPK
DKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL
LASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVTKRHQQIL
LYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID
VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE
LLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIIC
LISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLGLTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgccacagctgagcctgtcctcgctgggcctttggccaatggcagcatccccgtggctg
ctcctgctgctggttggggcctcctggctcctggcccgcatcctggcctggacctatacc
ttctatgacaactgctgccgcctccggtgtttcccgcaacccccgaaacggaattggttc
ttgggtcacctgggcctgattcacagctcggaggaaggtctcctatacacacaaagcctg
gcatgcaccttcggtgatatgtgctgctggtgggtggggccctggcacgcaatcgtccgc
atcttccaccccacctacatcaagcctgtgctctttgctccagctgccattgtaccaaag
gacaaggtcttctacagcttcctgaagccctggctgggggatgggctcctgctgagtgct
ggtgaaaagtggagccgccaccgtcggatgctgacgcctgccttccatttcaacatcctg
aagccctatatgaagattttcaatgagagtgtgaacatcatgcatgccaagtggcagctc
ctggcctcagagggtagtgcccgtctggacatgtttgagcacatcagcctcatgaccttg
gacagtctgcagaaatgtgtcttcagctttgacagccattgccaggagaagcccagtgaa
tatattgccgccatcttggagctcagtgcccttgtgacaaaaagacaccagcagatcctc
ctgtacatagacttcctgtattatctcacccctgatgggcagcgtttccgcagggcctgc
cgcctggtgcacgacttcacagatgccgtcatccaggagcggcgccgcaccctccctagc
cagggtgttgatgacttcctccaagccaaggccaaatccaagactttggacttcattgat
gtactcctgctgagcaaggatgaagatgggaagaagttgtccgatgaggacataagagca
gaagctgacacctttatgtttgagggccatgacaccacagccagtggtctctcctgggtc
ctgtaccaccttgcaaagcacccggaataccaggagcgctgtcggcaggaggtgcaagag
cttctgaaggaccgtgagcctaaagagattgaatgggacgacctggcccagctgcccttc
ctgaccatgtgcattaaggagagcctgaggctgcatcccccagtccctgccgtctctcgc
tgctgcacccaagacattgtgctcccagacggccgggtcatccccaaaggcattatctgc
ctcatcagtgtttttggaacccatcacaacccagccgtgtggccggaccctgaggtctat
gacccctttcgctttgacccaaagaacatcaaggagaggtcacctctggcttttattccc
ttctcagcagggcccaggaactgcatcgggcaggcgttcgcgatggcggagatgaaggtg
gtcctggggctcacgctgctgcgcttccgcgtcctgcctgaccacaccgagccccgcagg
aagccggagctggtcctgcgcgcagagggcggactttggctgcgggtggagcccctgagc
tga

KEGG   Homo sapiens (human): 8529
Entry
8529              CDS       T01001                                 

Symbol
CYP4F2, CPF2
Name
(RefSeq) cytochrome P450 family 4 subfamily F member 2
  KO
K17726  phylloquinone omega-hydroxylase / docosahexaenoic acid omega-hydroxylase / leukotriene-B4 20-monooxygenase [EC:1.14.14.78 1.14.14.79 1.14.14.94]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    8529 (CYP4F2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    8529 (CYP4F2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.78  phylloquinone omega-hydroxylase
     8529 (CYP4F2)
    1.14.14.79  docosahexaenoic acid omega-hydroxylase
     8529 (CYP4F2)
    1.14.14.94  leukotriene-B4 20-monooxygenase
     8529 (CYP4F2)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   8529 (CYP4F2)
SSDB
Motif
Pfam: p450 TetR_C_28
Other DBs
NCBI-GeneID: 8529
NCBI-ProteinID: NP_001073
OMIM: 604426
HGNC: 2645
Ensembl: ENSG00000186115
Vega: OTTHUMG00000185995
Pharos: P78329(Tbio)
UniProt: P78329
Position
19p13.12
AA seq 520 aa
MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWF
WGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPK
DKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL
LASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVSKRHHEIL
LHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID
VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE
LLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIIC
LISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKV
VLALTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgtcccagctgagcctgtcctggctgggcctctggccagtggcagcatccccttggctg
ctcctcctgctggtcggggcctcctggctcctggcccatgtcctggcctggacctacgcc
ttctatgacaactgccgccgccttcggtgtttcccacaacccccaagacggaactggttt
tggggacaccagggcatggtcaaccccacagaggagggcatgagagttctgactcagctg
gtggccacctacccccagggctttaaggtctggatgggacccatctcccccctcctcagt
ttgtgccaccccgacatcatccggtctgtcatcaacgcctcagctgccattgcaccaaag
gacaagttcttctacagcttcctggagccctggctgggggatgggctcctgctgagtgct
ggtgacaagtggagccgccaccgtcggatgctgacgcctgccttccatttcaacatcctg
aagccctatatgaagattttcaatgagagtgtgaacatcatgcacgccaagtggcagctc
ctggcctcagagggtagtgcctgtttggatatgtttgagcacatcagcctcatgaccttg
gacagtctacagaaatgtgtcttcagctttgacagccattgtcaggagaaacccagtgaa
tatattgccgccatcttggagctcagtgcccttgtatcaaaaagacaccatgagatcctc
ctgcatattgacttcctgtattatctcacccctgatgggcagcgtttccgcagggcctgc
cgcctggtgcacgacttcacagatgccgtcatccaggagcggcgccgcactctccctagc
cagggtgttgatgacttcctccaagccaaggccaaatccaagactttggacttcattgat
gtactcctgctgagcaaggatgaagacgggaagaagttatctgatgaggacataagagca
gaagctgacacctttatgtttgagggccatgacaccacggccagtggtctctcctgggtc
ctgtaccaccttgcaaagcacccagaataccaggagcgctgccggcaggaggtgcaagaa
cttctgaaggaccgtgagcctaaagagattgaatgggacgacctggcccatttgcccttc
ctgaccatgtgcatgaaggagagcctgcggctgcatcccccagtcccggtcatctcccgc
catgtcacccaggacattgtgctcccagacggccgggtcatccccaaaggcattatctgc
ctcatcagtgttttcggaacccatcacaacccagctgtgtggccggaccctgaggtctac
gacccctttcgctttgacccagagaacatcaaggagaggtcacctctggcttttattccc
ttctcggcagggcccaggaactgcatcgggcagacgttcgcgatggcggagatgaaggtg
gtcctggcgctcacgctgctgcgcttccgcgtcctgcctgaccacaccgagccccgcagg
aagccggagctggtcctgcgcgcagagggcggactttggctgcgggtggagcccctgagc
tga

DBGET integrated database retrieval system