KEGG   Homo sapiens (human): 4067Help
Entry
4067              CDS       T01001                                 

Gene name
LYN, JTK8, p53Lyn, p56Lyn
Definition
(RefSeq) LYN proto-oncogene, Src family tyrosine kinase
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04611  Platelet activation
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04730  Long-term depression
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06114  PI3K signaling (virus)
nt06120  Calcium signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06165  Epstein-Barr virus (EBV)
nt06220  Calcium signaling
  Element
N00266  EBV LMP2A to PI3K signaling pathway
N00487  BCR-PLCG-Calcineurin signaling pathway
N00488  EBV LMP2A to BCR signaling pathway
Drug target
Bafetinib: D10202
Tolimidone: D06182
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    4067 (LYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    4067 (LYN)
   04662 B cell receptor signaling pathway
    4067 (LYN)
   04664 Fc epsilon RI signaling pathway
    4067 (LYN)
   04666 Fc gamma R-mediated phagocytosis
    4067 (LYN)
   04062 Chemokine signaling pathway
    4067 (LYN)
  09156 Nervous system
   04730 Long-term depression
    4067 (LYN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    4067 (LYN)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4067 (LYN)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    4067 (LYN)
   05169 Epstein-Barr virus infection
    4067 (LYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4067 (LYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4067 (LYN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     4067 (LYN)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   4067 (LYN)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4067 (LYN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3
Motif
Other DBs
NCBI-GeneID: 4067
NCBI-ProteinID: NP_002341
OMIM: 165120
HGNC: 6735
Ensembl: ENSG00000254087
Vega: OTTHUMG00000044345
Pharos: P07948(Tclin)
UniProt: P07948 Q6NUK7 A8K379
Structure
PDB: 

Position
8q12.1
AA seq 512 aa AA seqDB search
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtataaaatcaaaagggaaagacagcttgagtgacgatggagtagatttgaag
actcaaccagtacgtaatactgaaagaactatttatgtgagagatccaacgtccaataaa
cagcaaaggccagttccagaatctcagcttttacctggacagaggtttcaaactaaagat
ccagaggaacaaggagacattgtggtagccttgtacccctatgatggcatccacccggac
gacttgtctttcaagaaaggagagaagatgaaagtcctggaggagcatggagaatggtgg
aaagcaaagtcccttttaacaaaaaaagaaggcttcatccccagcaactatgtggccaaa
ctcaacaccttagaaacagaagagtggtttttcaaggatataaccaggaaggacgcagaa
aggcagcttttggcaccaggaaatagcgctggagctttccttattagagaaagtgaaaca
ttaaaaggaagcttctctctgtctgtcagagactttgaccctgtgcatggtgatgttatt
aagcactacaaaattagaagtctggataatgggggctattacatctctccacgaatcact
tttccctgtatcagcgacatgattaaacattaccaaaagcaggcagatggcttgtgcaga
agattggagaaggcttgtattagtcccaagccacagaagccatgggataaagatgcctgg
gagatcccccgggagtccatcaagttggtgaaaaggcttggcgctgggcagtttggggaa
gtctggatgggttactataacaacagtaccaaggtggctgtgaaaaccctgaagccagga
actatgtctgtgcaagccttcctggaagaagccaacctcatgaagaccctgcagcatgac
aagctcgtgaggctctacgctgtggtcaccagggaggagcccatttacatcatcaccgag
tacatggccaagggcagtttgctggatttcctgaagagcgatgaaggtggcaaagtgctg
cttccaaagctcattgacttttctgctcagattgcagagggaatggcatacatcgagcgg
aagaactacattcaccgggacctgcgagcagctaatgttctggtctccgagtcactcatg
tgcaaaattgcagattttggccttgctagagtaattgaagataatgagtacacagcaagg
gaaggtgctaagttccctattaagtggacggctccagaagcaatcaactttggatgtttc
actattaagtctgatgtgtggtcctttggaatcctcctatacgaaattgtcacctatggg
aaaattccctacccagggagaactaatgccgacgtgatgaccgccctgtcccagggctac
aggatgccccgtgtggagaactgcccagatgagctctatgacattatgaaaatgtgctgg
aaagaaaaggcagaagagagaccaacgtttgactacttacagagcgtcctggatgatttc
tacacagccacggaagggcaataccagcagcagccttag

DBGET integrated database retrieval system