KEGG   Homo sapiens (human): 4214Help
Entry
4214              CDS       T01001                                 

Gene name
MAP3K1, MAPKKK1, MEKK, MEKK_1, MEKK1, SRXY6
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04530  Tight junction
hsa04622  RIG-I-like receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04912  GnRH signaling pathway
hsa05161  Hepatitis B
hsa05166  HTLV-I infection
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Disease
H00607  46,XY disorders of sex development (Disorders of gonadal development)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4214 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4214 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4214 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    4214 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    4214 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4214 (MAP3K1)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    4214 (MAP3K1)
   05161 Hepatitis B
    4214 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4214 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    4214 (MAP3K1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4214 (MAP3K1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4214 (MAP3K1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4214 (MAP3K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like zf-RING_2 PHD APH Phostensin_N FANCL_C zf-ANAPC11
Motif
Other DBs
NCBI-GeneID: 4214
NCBI-ProteinID: NP_005912
OMIM: 600982
HGNC: 6848
Ensembl: ENSG00000095015
Vega: OTTHUMG00000059486
Pharos: Q13233(Tbio)
UniProt: Q13233
Position
5q11.2
AA seq 1512 aa AA seqDB search
MAAAAGNRASSSGFPGARATSPEAGGGGGALKASSAPAAAAGLLREAGSGGRERADWRRR
QLRKVRSVELDQLPEQPLFLAASPPASSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRG
GAHLTESVAAPDSGASSPAAAEPGEKRAPAAEPSPAAAPAGREMENKETLKGLHKMDDRP
EERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHLAAESPGEVQASA
ASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYS
PEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCARGTFCIHLLF
VMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECR
RNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTVQQQPLAGSRRNQESNFN
LTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANG
ESTGNSGGSSGSSPSGGATSGSSQTSISGDVVEACCSVLSMVCADPVYKVYVAALKTLRA
MLVYTPCHSLAERIKLQRLLQPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAVG
REILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTD
VSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLEM
LSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASVPNNYLETTENS
SPECTVHLEKTGKGLCATKLSASSEDISERLASISVGPSSSTTTTTTTTEQPKPMVQTKG
RPHSQCLNSSPLSHHSQLMFPALSTPSSSTPSVPAGTATDVSKHRLQGFIPCRIPSASPQ
TQRKFSLQFHRNCPENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSKQGDPSKNS
MTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASM
PSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQD
ALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQA
QDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYN
LFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDST
GQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAII
EMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSR
ELLKHPVFRTTW
NT seq 4539 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccagggctacg
agccctgaggcaggcggcggcggaggagccctcaaggcgagcagcgcgcccgcggctgcc
gcgggactgctgcgggaggcgggcagcgggggccgcgagcgggcggactggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccagctgcctgagcagccgctcttcctt
gccgcctcaccgccggcctcctcgacttccccgtcgccggagcccgcggacgcagcgggg
agtgggaccggcttccagcctgtggcggtgccgccgccccacggagccgcgagccgcggc
ggcgcccaccttaccgagtcggtggcggcgccggacagcggcgcctcgagtcccgcagcg
gccgagcccggggagaagcgggcgcccgccgccgagccgtctcctgcagcggcccccgcc
ggtcgtgagatggagaataaagaaactctcaaagggttgcacaagatggatgatcgtcca
gaggaacgaatgatcagggagaaactgaaggcaacctgtatgccagcctggaagcacgaa
tggttggaaaggagaaataggcgagggcctgtggtggtaaaaccaatcccagttaaagga
gatggatctgaaatgaatcacttagcagctgagtctccaggagaggtccaggcaagtgcg
gcttcaccagcttccaaaggccgacgcagtccttctcctggcaactccccatcaggtcgc
acagtgaaatcagaatctccaggagtaaggagaaaaagagtttccccagtgccttttcag
agtggcagaatcacaccaccccgaagagccccttcaccagatggcttctcaccatatagc
cctgaggaaacaaaccgccgtgttaacaaagtgatgcgggccagactgtacttactgcag
cagatagggcctaactctttcctgattggaggagacagcccagacaataaataccgggtg
tttattgggcctcagaactgcagctgtgcacgtggaacattctgtattcatctgctattt
gtgatgctccgggtgtttcaactagaaccttcagacccaatgttatggagaaaaacttta
aagaattttgaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatc
aaagctccatctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcataca
ttgtcatcatctagtacttctacgtctagttcagaaaacagcataaaggatgaagaggaa
cagatgtgtcctatttgcttgttgggcatgcttgatgaagaaagtcttacagtgtgtgaa
gacggctgcaggaacaagctgcaccaccactgcatgtcaatttgggcagaagagtgtaga
agaaatagagaacctttaatatgtcccctttgtagatctaagtggagatctcatgatttc
tacagccacgagttgtcaagtcctgtggattccccttcttccctcagagctgcacagcag
caaaccgtacagcagcagcctttggctggatcacgaaggaatcaagagagcaattttaac
cttactcattatggaactcagcaaatccctcctgcttacaaagatttagctgagccatgg
attcaggtgtttggaatggaactcgttggctgcttattttctagaaactggaatgtgaga
gagatggccctcaggcgtctttcccatgatgtcagtggggccctgctgttggcaaatggg
gagagcactggaaattctgggggcagcagtggaagcagcccgagtgggggagccaccagt
gggtcttcccagaccagtatctcaggagatgtggtggaggcatgctgcagcgttctgtca
atggtctgtgctgaccctgtctacaaagtgtacgttgctgctttaaaaacattgagagcc
atgctggtatatactccttgccacagtttagcggaaagaatcaaacttcagagacttctc
cagccagttgtagacaccatcctagtcaaatgtgcagatgccaatagccgcacaagtcag
ctgtccatatcaacactgttggaactgtgcaaaggccaagcaggagagttggcagttggc
agagaaatactaaaagctggatccattggtattggtggtgttgattatgtcttaaattgt
attcttggaaaccaaactgaatcaaacaattggcaagaacttcttggccgcctttgtctt
atagatagactgttgttggaatttcctgctgaattttatcctcatattgtcagtactgat
gtttcacaagctgagcctgttgaaatcaggtataagaagctgctgtccctcttaaccttt
gctttgcagtccattgataattcccactcaatggttggcaaactttccagaaggatctac
ttgagttctgcaagaatggttactacagtaccccatgtgttttcaaaactgttagaaatg
ctgagtgtttccagttccactcacttcaccaggatgcgtcgccgtttgatggctattgca
gatgaggtggaaattgccgaagccatccagttgggcgtagaagacactttggatggtcaa
caggacagcttcttgcaggcatctgttcccaacaactatctggaaaccacagagaacagt
tcccctgagtgcacagtccatttagagaaaactggaaaaggattatgtgctacaaaattg
agtgccagttcagaggacatttctgagagactggccagcatttcagtaggaccttctagt
tcaacaacaacaacaacaacaacaacagagcaaccaaagccaatggttcaaacaaaaggc
agaccccacagtcagtgtttgaactcctctcctttatctcatcattcccaattaatgttt
ccagccttgtcaaccccttcttcttctaccccatctgtaccagctggcactgcaacagat
gtctctaagcatagacttcagggattcattccctgcagaataccttctgcatctcctcaa
acacagcgcaagttttctctacaattccacagaaactgtcctgaaaacaaagactcagat
aaactttccccagtctttactcagtcaagacccttgccctccagtaacatacacaggcca
aagccatctagacctaccccaggtaatacaagtaaacagggagatccctcaaaaaatagc
atgacacttgatctgaacagtagttccaaatgtgatgacagctttggctgtagcagcaat
agtagtaatgctgttatacccagtgacgagacagtgttcaccccagtagaggagaaatgc
agattagatgtcaatacagagctcaactccagtattgaggaccttcttgaagcatctatg
ccttcaagtgatacaacagtaacttttaagtcagaagttgctgtcctgtctcctgaaaag
gctgaaaatgatgatacctacaaagatgatgtgaatcataatcaaaagtgcaaagagaag
atggaagctgaagaagaagaagctttagcaattgccatggcaatgtcagcgtctcaggat
gccctccccatagttcctcagctgcaggttgaaaatggagaagatatcatcattattcaa
caggatacaccagagactctaccaggacataccaaagcaaaacaaccgtatagagaagac
actgaatggctgaaaggtcaacagataggccttggagcattttcttcttgttatcaggct
caagatgtgggaactggaactttaatggctgttaaacaggtgacttatgtcagaaacaca
tcttctgagcaagaagaagtagtagaagcactaagagaagagataagaatgatgagccat
ctgaatcatccaaacatcattaggatgttgggagccacgtgtgagaagagcaattacaat
ctcttcattgaatggatggcagggggatcggtggctcatttgctgagtaaatatggagcc
ttcaaagaatcagtagttattaactacactgaacagttactccgtggcctttcgtatctc
catgaaaaccaaatcattcacagagatgtcaaaggtgccaatttgctaattgacagcact
ggtcagagactaagaattgcagattttggagctgcagccaggttggcatcaaaaggaact
ggtgcaggagagtttcagggacaattactggggacaattgcatttatggcacctgaggta
ctaagaggtcaacagtatggaaggagctgtgatgtatggagtgttggctgtgctattata
gaaatggcttgtgcaaaaccaccatggaatgcagaaaaacactccaatcatcttgctttg
atatttaagattgctagtgcaactactgctccatcgatcccttcacatttgtctcctggt
ttacgagatgtggctcttcgttgtttagaacttcaacctcaggacagacctccatcaaga
gagctactgaagcatccagtctttcgtactacatggtag

DBGET integrated database retrieval system