KEGG   Homo sapiens (human): 4296Help
Entry
4296              CDS       T01001                                 

Gene name
MAP3K11, MEKK11, MLK-3, MLK3, PTK1, SPRK
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 11
  KO
K04419  mitogen-activated protein kinase kinase kinase 11 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4296 (MAP3K11)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4296 (MAP3K11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4296 (MAP3K11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4296 (MAP3K11)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   4296 (MAP3K11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH3_9 SH3_1 SH3_2 DUF4393 APG6
Motif
Other DBs
NCBI-GeneID: 4296
NCBI-ProteinID: NP_002410
OMIM: 600050
HGNC: 6850
Ensembl: ENSG00000173327
Vega: OTTHUMG00000166529
Pharos: Q16584(Tchem)
UniProt: Q16584 A0A024R5E6
Structure
PDB: 

Position
11q13.1
AA seq 847 aa AA seqDB search
MEPLKSLFLKSPLGSWNGSGSGGGGGGGGGRPEGSPKAAGYANPVWTALFDYEPSGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLE
EVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALK
AVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR
DLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFS
KGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA
QDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSR
EEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKR
SKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEP
GQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPL
GSPSTPPALNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQRALLRGTALLASLGLGRD
LQPPGGPGRERGESPTTPPTPTPAPCPTEPPPSPLICFSLKTPDSPPTPAPLLLDLGIPV
GQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWS
FVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAP
WVPEAGP
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggagcccttgaagagcctcttcctcaagagccctctagggtcatggaatggcagtggc
agcgggggtggtgggggcggtggaggaggccggcctgaggggtctccaaaggcagcgggt
tatgccaacccggtgtggacagccctgttcgactacgagcccagtgggcaggatgagctg
gccctgaggaagggtgaccgtgtggaggtgctgtcccgggacgcagccatctcaggagac
gagggctggtgggcgggccaggtgggtggccaggtgggcatcttcccgtccaactatgtg
tctcggggtggcggcccgcccccctgcgaggtggccagcttccaggagctgcggctggag
gaggtgatcggcattggaggctttggcaaggtgtacaggggcagctggcgaggtgagctg
gtggctgtgaaggcagctcgccaggaccccgatgaggacatcagtgtgacagccgagagc
gttcgccaggaggcccggctcttcgccatgctggcacaccccaacatcattgccctcaag
gctgtgtgcctggaggagcccaacctgtgcctggtgatggagtatgcagccggtgggccc
ctcagccgagctctggccgggcggcgcgtgcctccccatgtgctggtcaactgggctgtg
cagattgcccgtgggatgcactacctgcactgcgaggccctggtgcccgtcatccaccgt
gatctcaagtccaacaacattttgctgctgcagcccattgagagtgacgacatggagcac
aagaccctgaagatcaccgactttggcctggcccgagagtggcacaaaaccacacaaatg
agtgccgcgggcacctacgcctggatggctcctgaggttatcaaggcctccaccttctct
aagggcagtgacgtctggagttttggggtgctgctgtgggaactgctgaccggggaggtg
ccataccgtggcattgactgccttgctgtggcctatggcgtagctgttaacaagctcaca
ctgcccatcccatccacctgccccgagcccttcgcacagcttatggccgactgctgggcg
caggacccccaccgcaggcccgacttcgcctccatcctgcagcagttggaggcgctggag
gcacaggtcctacgggaaatgccgcgggactccttccattccatgcaggaaggctggaag
cgcgagatccagggtctcttcgacgagctgcgagccaaggaaaaggaactactgagccgc
gaggaggagctgacgcgagcggcgcgcgagcagcggtcacaggcggagcagctgcggcgg
cgcgagcacctgctggcccagtgggagctagaggtgttcgagcgcgagctgacgctgctg
ctgcagcaggtggaccgcgagcgaccgcacgtgcgccgccgccgcgggacattcaagcgc
agcaagctccgggcgcgcgacggcggcgagcgtatcagcatgccactcgacttcaagcac
cgcatcaccgtgcaggcctcacccggccttgaccggaggagaaacgtcttcgaggtcggg
cctggggattcgcccacctttccccggttccgagccatccagttggagcctgcagagcca
ggccaggcatggggccgccagtccccccgacgtctggaggactcaagcaatggagagcgg
cgagcatgctgggcttggggtcccagttcccccaagcctggggaagcccagaatgggagg
agaaggtcccgcatggacgaagccacatggtacctggattcagatgactcatccccctta
ggatctccttccacacccccagcactcaatggtaaccccccgcggcctagcctggagccc
gaggagcccaagaggcctgtccccgcagagcgcggtagcagctctgggacgcccaagctg
atccagcgggcgctgctgcgcggcaccgccctgctcgcctcgctgggccttggccgcgac
ctgcagccgccgggaggcccaggacgcgagcgcggggagtccccgacaacaccccccacg
ccaacgcccgcgccctgcccgaccgagccgcccccttccccgctcatctgcttctcgctc
aagacgcccgactccccgcccactcctgcacccctgttgctggacctgggtatccctgtg
ggccagcggtcagccaagagcccccgacgtgaggaggagccccgcggaggcactgtctca
cccccaccggggacatcacgctctgctcctggcaccccaggcaccccacgttcaccaccc
ctgggcctcatcagccgacctcggccctcgccccttcgcagccgcattgatccctggagc
tttgtgtcagctgggccacggccttctcccctgccatcaccacagcctgcaccccgccga
gcaccctggaccttgttcccggactcagaccccttctgggactccccacctgccaacccc
ttccaggggggcccccaggactgcagggcacagaccaaagacatgggtgcccaggccccg
tgggtgccggaagcggggccttga

DBGET integrated database retrieval system