KEGG   Homo sapiens (human): 440077
Entry
440077            CDS       T01001                                 

Gene name
ZNF705A
Definition
(RefSeq) zinc finger protein 705A
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    440077 (ZNF705A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    440077 (ZNF705A)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    440077 (ZNF705A)
SSDB
Motif
Pfam: zf-H2C2_2 KRAB zf-C2H2 zf-C2H2_4 zf-C2H2_11 GAGA
Other DBs
NCBI-GeneID: 440077
NCBI-ProteinID: NP_001004328
HGNC: 32281
Ensembl: ENSG00000196946
Vega: OTTHUMG00000168635
Pharos: Q6ZN79(Tdark)
UniProt: Q6ZN79
Position
12p13.31
AA seq 300 aa
MHSLKKVTFEDVAIDFTQEEWAMMDTSKRKLYRDVMLENISHLVSLGYQISKSYIILQLE
QGKELWREGREFLQDQNPDRESALKKKHMISMHPITRKDASTSMTMENSLILEDPFECND
SGEDCTHSSTITQRLLTHSGKKPYVSKQCGKSLRNLFSPKPHKQIHTKGKSYQCNLCEKA
YTNCFRLRRHKMTHTGERPYACHLCGKAFTQCSHLRRHEKTHTGERPYKCHQCGKAFIQS
FNLRRHERTHLGKKCYECDKSGKAFSQSSGFRGNKIIHTGEKPHACLLCGKAFSLSSDLR
NT seq 903 nt   +upstreamnt  +downstreamnt
atgcattcactaaagaaagtgacttttgaagatgtagctattgacttcacccaggaagag
tgggccatgatggacacatccaagagaaagctgtacagagatgtgatgctggaaaatatc
agtcacctggtgtccctcgggtaccagataagcaaatcctatataattttgcagctggag
caaggaaaagagctgtggcgggaaggaagagaatttcttcaagaccagaatccagacagg
gaaagtgcccttaagaaaaaacacatgatatccatgcatcctatcaccagaaaagacgca
tccaccagtatgacaatggagaactctctcattctggaggatccttttgaatgtaatgat
tcgggagaagattgcactcacagttccacaataactcagcgtttgttaactcacagtgga
aagaaaccctatgtcagcaaacagtgtggaaaatctcttcgtaatcttttctcccctaaa
ccacataaacaaattcatactaaaggtaaatcatatcaatgtaatctatgtgaaaaggcc
tatactaattgctttcgccttagacggcacaagatgactcacactggagagaggccatat
gcatgtcatctatgtggaaaagccttcactcagtgttctcaccttagaagacatgagaaa
actcacacgggagagagaccatataagtgtcatcaatgtgggaaagcctttattcaatcc
tttaaccttcgaagacatgagagaactcaccttggaaaaaagtgttatgaatgtgataaa
agtgggaaagcctttagtcaaagctctggctttagaggaaacaaaataattcacactgga
gagaaaccacatgcttgtcttctatgtgggaaggccttcagtctgtcttccgaccttaga
tga

DBGET integrated database retrieval system