KEGG   Homo sapiens (human): 4595
Entry
4595              CDS       T01001                                 
Symbol
MUTYH, MYH
Name
(RefSeq) mutY DNA glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Network
  Element
N01433  Base excision and strand cleavage by monofunctional glycosylase
Disease
H00018  Gastric cancer
H01025  Familial adenomatous polyposis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4595 (MUTYH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4595 (MUTYH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     4595 (MUTYH)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4595 (MUTYH)
 Prokaryotic type
     4595 (MUTYH)
SSDB
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-GeneID: 4595
NCBI-ProteinID: NP_036354
OMIM: 604933
HGNC: 7527
Ensembl: ENSG00000132781
Pharos: Q9UIF7(Tbio)
UniProt: Q9UIF7 E5KP26
Structure
Position
1:complement(45329242..45340440)
AA seq 546 aa
MTPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDGMIAECPG
APAGLARQPEEVVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDL
DRRAYAVWVSEVMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRG
RRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVL
CRVRAIGADPSSTLVSQQLWGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVE
SLCRARQRVEQEQLLASGSLSGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKAS
RKPPREESSATCVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQE
LQRWAGPLPATHLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHT
AAVSTAMKKVFRVYQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHS
LNSAAQ
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgacaccgctcgtctcccgcctgagtcgtctgtgggccatcatgaggaagccacgagca
gccgtgggaagtggtcacaggaagcaggcagccagccaggaagggaggcagaagcatgct
aagaacaacagtcaggccaagccttctgcctgtgatgggatgattgctgagtgtcctggg
gccccagcaggcctggccaggcagccggaagaggtggtattgcaggcctctgtctcctca
taccatctattcagagacgtagctgaagtcacagccttccgagggagcctgctaagctgg
tacgaccaagagaaacgggacctaccatggagaagacgggcagaagatgagatggacctg
gacaggcgggcatatgctgtgtgggtctcagaggtcatgctgcagcagacccaggttgcc
actgtgatcaactactataccggatggatgcagaagtggcctacactgcaggacctggcc
agtgcttccctggaggaggtgaatcaactctgggctggcctgggctactattctcgtggc
cggcggctgcaggagggagctcggaaggtggtagaggagctagggggccacatgccacgt
acagcagagaccctgcagcagctcctgcctggcgtggggcgctacacagctggggccatt
gcctctatcgcctttggccaggcaaccggtgtggtggatggcaacgtagcacgggtgctg
tgccgtgtccgagccattggtgctgatcccagcagcacccttgtttcccagcagctctgg
ggtctagcccagcagctggtggacccagcccggccaggagatttcaaccaagcagccatg
gagctaggggccacagtgtgtaccccacagcgcccactgtgcagccagtgccctgtggag
agcctgtgccgggcacgccagagagtggagcaggaacagctcttagcctcagggagcctg
tcgggcagtcctgacgtggaggagtgtgctcccaacactggacagtgccacctgtgcctg
cctccctcggagccctgggaccagaccctgggagtggtcaacttccccagaaaggccagc
cgcaagccccccagggaggagagctctgccacctgtgttctggaacagcctggggccctt
ggggcccaaattctgctggtgcagaggcccaactcaggtctgctggcaggactgtgggag
ttcccgtccgtgacctgggagccctcagagcagcttcagcgcaaggccctgctgcaggaa
ctacagcgttgggctgggcccctcccagccacgcacctccggcaccttggggaggttgtc
cacaccttctctcacatcaagctgacatatcaagtatatgggctggccttggaagggcag
accccagtgaccaccgtaccaccaggtgctcgctggctgacgcaggaggaatttcacacc
gcagctgtttccaccgccatgaaaaaggttttccgtgtgtatcagggccaacagccaggg
acctgtatgggttccaaaaggtcccaggtgtcctctccgtgcagtcggaaaaagccccgc
atgggccagcaagtcctggataatttctttcggtctcacatctccactgatgcacacagc
ctcaacagtgcagcccagtga

DBGET integrated database retrieval system