KEGG   Homo sapiens (human): 4689Help
Entry
4689              CDS       T01001                                 

Gene name
NCF4, CGD3, NCF, P40PHOX, SH3PXD4
Definition
(RefSeq) neutrophil cytosolic factor 4
  KO
K08012  neutrophil cytosolic factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04670  Leukocyte transendothelial migration
hsa05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4689 (NCF4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    4689 (NCF4)
  09158 Development
   04380 Osteoclast differentiation
    4689 (NCF4)
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    4689 (NCF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4689 (NCF4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    4689 (NCF4)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    4689 (NCF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX PB1 SH3_1 SH3_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 4689
NCBI-ProteinID: NP_000622
OMIM: 601488
HGNC: 7662
Ensembl: ENSG00000100365
Vega: OTTHUMG00000150548
Pharos: Q15080(Tbio)
UniProt: Q15080
Structure
PDB: 

Position
22q12.3
AA seq 339 aa AA seqDB search
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP
VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFD
FTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL
RCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSD
EDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcccagcagctgcgggccgagagtgactttgaacagcttccggatgatgtt
gccatctcggccaacattgctgacatcgaggagaagagaggcttcaccagccactttgtt
ttcgtcatcgaggtgaagacaaaaggaggatccaagtacctcatctaccgccgctaccgc
cagttccatgctttgcagagcaagctggaggagcgcttcgggccagacagcaagagcagt
gccctggcctgtaccctgcccacactcccagccaaagtctacgtgggtgtgaaacaggag
atcgccgagatgcggatacctgccctcaacgcctacatgaagagcctgctcagcctgccg
gtctgggtgctgatggatgaggacgtccggatcttcttttaccagtcgccctatgactca
gagcaggtgccccaggcactccgccggctccgcccgcgcacccggaaagtcaagagcgtg
tccccacagggcaacagcgttgaccgcatggcagctccgagagcagaggctctatttgac
ttcactggaaacagcaaactggagctgaatttcaaagctggagatgtgatcttcctcctc
agtcggatcaacaaagactggctggagggcactgtccggggagccacgggcatcttccct
ctctccttcgtgaagatcctcaaagacttccctgaggaggacgaccccaccaactggctg
cgttgctactactacgaagacaccatcagcaccatcaaggacatcgcggtggaggaagat
ctcagcagcactcccctattgaaagacctgctggagctcacaaggcgggagttccagaga
gaggacatagctctgaattaccgggacgctgagggggatctggttcggctgctgtcggat
gaggacgtagcgctcatggtgcggcaggctcgtggcctcccctcccagaagcgcctcttc
ccctggaagctgcacatcacgcagaaggacaactacagggtctacaacacgatgccatga

DBGET integrated database retrieval system