KEGG   Homo sapiens (human): 4703
Entry
4703              CDS       T01001                                 
Symbol
NEB, AMC6, NEB177D, NEM2
Name
(RefSeq) nebulin
  KO
K18267  nebulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01819  Actin thin filament, length regulation
Disease
H00698  Nemaline myopathy
H02299  Arthrogryposis multiplex congenita
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    4703 (NEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4703 (NEB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
    4703 (NEB)
SSDB
Motif
Pfam: Nebulin Peptidase_M24 SH3_9 SH3_1 SH3_2
Other DBs
NCBI-GeneID: 4703
NCBI-ProteinID: NP_004534
OMIM: 161650
HGNC: 7720
Ensembl: ENSG00000183091
UniProt: P20929 Q96MF8 Q05C45
Position
2:complement(151485339..151734476)
AA seq 6669 aa
MADDEDYEEVVEYYTEEVVYEEVPGETITKIYETTTTRTSDYEQSETSKPALAQPALAQP
ASAKPVERRKVIRKKVDPSKFMTPYIAHSQKMQDLFSPNKYKEKFEKTKGQPYASTTDTP
ELRRIKKVQDQLSEVKYRMDGDVAKTICHVDEKAKDIEHAKKVSQQVSKVLYKQNWEDTK
DKYLLPPDAPELVQAVKNTAMFSKKLYTEDWEADKSLFYPYNDSPELRRVAQAQKALSDV
AYKKGLAEQQAQFTPLADPPDIEFAKKVTNQVSKQKYKEDYENKIKGKWSETPCFEVANA
RMNADNISTRKYQEDFENMKDQIYFMQTETPEYKMNKKAGVAASKVKYKEDYEKNKGKAD
YNVLPASENPQLRQLKAAGDALSDKLYKENYEKTKAKSINYCETPKFKLDTVLQNFSSDK
KYKDSYLKDILGHYVGSFEDPYHSHCMKVTAQNSDKNYKAEYEEDRGKGFFPQTITQEYE
AIKKLDQCKDHTYKVHPDKTKFTQVTDSPVLLQAQVNSKQLSDLNYKAKHESEKFKCHIP
PDTPAFIQHKVNAYNLSDNLYKQDWEKSKAKKFDIKVDAIPLLAAKANTKNTSDVMYKKD
YEKNKGKMIGVLSINDDPKMLHSLKVAKNQSDRLYKENYEKTKAKSMNYCETPKYQLDTQ
LKNFSEARYKDLYVKDVLGHYVGSMEDPYHTHCMKVAAQNSDKSYKAEYEEDKGKCYFPQ
TITQEYEAIKKLDQCKDHTYKVHPDKTKFTAVTDSPVLLQAQLNTKQLSDLNYKAKHEGE
KFKCHIPADAPQFIQHRVNAYNLSDNVYKQDWEKSKAKKFDIKVDAIPLLAAKANTKNTS
DVMYKKDYEKSKGKMIGALSINDDPKMLHSLKTAKNQSDREYRKDYEKSKTIYTAPLDML
QVTQAKKSQAIASDVDYKHILHSYSYPPDSINVDLAKKAYALQSDVEYKADYNSWMKGCG
WVPFGSLEMEKAKRASDILNEKKYRQHPDTLKFTSIEDAPITVQSKINQAQRSDIAYKAK
GEEIIHKYNLPPDLPQFIQAKVNAYNISENMYKADLKDLSKKGYDLRTDAIPIRAAKAAR
QAASDVQYKKDYEKAKGKMVGFQSLQDDPKLVHYMNVAKIQSDREYKKDYEKTKSKYNTP
HDMFNVVAAKKAQDVVSNVNYKHSLHHYTYLPDAMDLELSKNMMQIQSDNVYKEDYNNWM
KGIGWIPIGSLDVEKVKKAGDALNEKKYRQHPDTLKFTSIVDSPVMVQAKQNTKQVSDIL
YKAKGEDVKHKYTMSPDLPQFLQAKCNAYNISDVCYKRDWYDLIAKGNNVLGDAIPITAA
KASRNIASDYKYKEAYEKSKGKHVGFRSLQDDPKLVHYMNVAKLQSDREYKKNYENTKTS
YHTPGDMVSITAAKMAQDVATNVNYKQPLHHYTYLPDAMSLEHTRNVNQIQSDNVYKDEY
NSFLKGIGWIPIGSLEVEKVKKAGDALNERKYRQHPDTVKFTSVPDSMGMVLAQHNTKQL
SDLNYKVEGEKLKHKYTIDPELPQFIQAKVNALNMSDAHYKADWKKTIAKGYDLRPDAIP
IVAAKSSRNIASDCKYKEAYEKAKGKQVGFLSLQDDPKLVHYMNVAKIQSDREYKKGYEA
SKTKYHTPLDMVSVTAAKKSQEVATNANYRQSYHHYTLLPDALNVEHSRNAMQIQSDNLY
KSDFTNWMKGIGWVPIESLEVEKAKKAGEILSEKKYRQHPEKLKFTYAMDTMEQALNKSN
KLNMDKRLYTEKWNKDKTTIHVMPDTPDILLSRVNQITMSDKLYKAGWEEEKKKGYDLRP
DAIAIKAARASRDIASDYKYKKAYEQAKGKHIGFRSLEDDPKLVHFMQVAKMQSDREYKK
GYEKSKTSFHTPVDMLSVVAAKKSQEVATNANYRNVIHTYNMLPDAMSFELAKNMMQIQS
DNQYKADYADFMKGIGWLPLGSLEAEKNKKAMEIISEKKYRQHPDTLKYSTLMDSMNMVL
AQNNAKIMNEHLYKQAWEADKTKVHIMPDIPQIILAKANAINMSDKLYKLSLEESKKKGY
DLRPDAIPIKAAKASRDIASDYKYKYNYEKGKGKMVGFRSLEDDPKLVHSMQVAKMQSDR
EYKKNYENTKTSYHTPADMLSVTAAKDAQANITNTNYKHLIHKYILLPDAMNIELTRNMN
RIQSDNEYKQDYNEWYKGLGWSPAGSLEVEKAKKATEYASDQKYRQHPSNFQFKKLTDSM
DMVLAKQNAHTMNKHLYTIDWNKDKTKIHVMPDTPDILQAKQNQTLYSQKLYKLGWEEAL
KKGYDLPVDAISVQLAKASRDIASDYKYKQGYRKQLGHHVGFRSLQDDPKLVLSMNVAKM
QSEREYKKDFEKWKTKFSSPVDMLGVVLAKKCQELVSDVDYKNYLHQWTCLPDQNDVVQA
KKVYELQSENLYKSDLEWLRGIGWSPLGSLEAEKNKRASEIISEKKYRQPPDRNKFTSIP
DAMDIVLAKTNAKNRSDRLYREAWDKDKTQIHIMPDTPDIVLAKANLINTSDKLYRMGYE
ELKRKGYDLPVDAIPIKAAKASREIASEYKYKEGFRKQLGHHIGARNIEDDPKMMWSMHV
AKIQSDREYKKDFEKWKTKFSSPVDMLGVVLAKKCQTLVSDVDYKNYLHQWTCLPDQSDV
IHARQAYDLQSDNLYKSDLQWLKGIGWMTSGSLEDEKNKRATQILSDHVYRQHPDQFKFS
SLMDSIPMVLAKNNAITMNHRLYTEAWDKDKTTVHIMPDTPEVLLAKQNKVNYSEKLYKL
GLEEAKRKGYDMRVDAIPIKAAKASRDIASEFKYKEGYRKQLGHHIGARAIRDDPKMMWS
MHVAKIQSDREYKKDFEKWKTKFSSPVDMLGVVLAKKCQTLVSDVDYKNYLHQWTCLPDQ
SDVIHARQAYDLQSDNMYKSDLQWMRGIGWVSIGSLDVEKCKRATEILSDKIYRQPPDRF
KFTSVTDSLEQVLAKNNALNMNKRLYTEAWDKDKTQIHIMPDTPEIMLARQNKINYSETL
YKLANEEAKKKGYDLRSDAIPIVAAKASRDVISDYKYKDGYRKQLGHHIGARNIEDDPKM
MWSMHVAKIQSDREYKKDFEKWKTKFSSPVDMLGVVLAKKCQTLVSDVDYKNYLHEWTCL
PDQNDVIHARQAYDLQSDNIYKSDLQWLRGIGWVPIGSMDVVKCKRAAEILSDNIYRQPP
DKLKFTSVTDSLEQVLAKNNALNMNKRLYTEAWDKDKTQVHIMPDTPEIMLARQNKINYS
ESLYRQAMEEAKKEGYDLRSDAIPIVAAKASRDIASDYKYKEAYRKQLGHHIGARAVHDD
PKIMWSLHIAKVQSDREYKKDFEKYKTRYSSPVDMLGIVLAKKCQTLVSDVDYKHPLHEW
ICLPDQNDIIHARKAYDLQSDNLYKSDLEWMKGIGWVPIDSLEVVRAKRAGELLSDTIYR
QRPETLKFTSITDTPEQVLAKNNALNMNKRLYTEAWDNDKKTIHVMPDTPEIMLAKLNRI
NYSDKLYKLALEESKKEGYDLRLDAIPIQAAKASRDIASDYKYKEGYRKQLGHHIGARNI
KDDPKMMWSIHVAKIQSDREYKKEFEKWKTKFSSPVDMLGVVLAKKCQILVSDIDYKHPL
HEWTCLPDQNDVIQARKAYDLQSDAIYKSDLEWLRGIGWVPIGSVEVEKVKRAGEILSDR
KYRQPADQLKFTCITDTPEIVLAKNNALTMSKHLYTEAWDADKTSIHVMPDTPDILLAKS
NSANISQKLYTKGWDESKMKDYDLRADAISIKSAKASRDIASDYKYKEAYEKQKGHHIGA
QSIEDDPKIMCAIHAGKIQSEREYKKEFQKWKTKFSSPVDMLSILLAKKCQTLVTDIDYR
NYLHEWTCMPDQNDIIQAKKAYDLQSDALYKADLEWLRGIGWMPQGSPEVLRVKNAQNIF
CDSVYRTPVVNLKYTSIVDTPEVVLAKSNAENISIPKYREVWDKDKTSIHIMPDTPEINL
ARANALNVSNKLYREGWDEMKAGCDVRLDAIPIQAAKASREIASDYKYKLDHEKQKGHYV
GTLTARDDNKIRWALIADKLQNEREYRLDWAKWKAKIQSPVDMLSILHSKNSQALVSDMD
YRNYLHQWTCMPDQNDVIQAKKAYELQSDNVYKADLEWLRGIGWMPNDSVSVNHAKHAAD
IFSEKKYRTKIETLNFTPVDDRVDYVTAKQSGEILDDIKYRKDWNATKSKYTLTETPLLH
TAQEAARILDQYLYKEGWERQKATGYILPPDAVPFVHAHHCNDVQSELKYKAEHVKQKGH
YVGVPTMRDDPKLVWFEHAGQIQNERLYKEDYHKTKAKINIPADMVSVLAAKQGQTLVSD
IDYRNYLHQWMCHPDQNDVIQARKAYDLQSDNVYRADLEWLRGIGWIPLDSVDHVRVTKN
QEMMSQIKYKKNALENYPNFRSVVDPPEIVLAKINSVNQSDVKYKETFNKAKGKYTFSPD
TPHISHSKDMGKLYSTILYKGAWEGTKAYGYTLDERYIPIVGAKHADLVNSELKYKETYE
KQKGHYLAGKVIGEFPGVVHCLDFQKMRSALNYRKHYEDTKANVHIPNDMMNHVLAKRCQ
YILSDLEYRHYFHQWTSLLEEPNVIRVRNAQEILSDNVYKDDLNWLKGIGCYVWDTPQIL
HAKKSYDLQSQLQYTAAGKENLQNYNLVTDTPLYVTAVQSGINASEVKYKENYHQIKDKY
TTVLETVDYDRTRNLKNLYSSNLYKEAWDRVKATSYILPSSTLSLTHAKNQKHLASHIKY
REEYEKFKALYTLPRSVDDDPNTARCLRVGKLNIDRLYRSVYEKNKMKIHIVPDMVEMVT
AKDSQKKVSEIDYRLRLHEWICHPDLQVNDHVRKVTDQISDIVYKDDLNWLKGIGCYVWD
TPEILHAKHAYDLRDDIKYKAHMLKTRNDYKLVTDTPVYVQAVKSGKQLSDAVYHYDYVH
SVRGKVAPTTKTVDLDRALHAYKLQSSNLYKTSLRTLPTGYRLPGDTPHFKHIKDTRYMS
SYFKYKEAYEHTKAYGYTLGPKDVPFVHVRRVNNVTSERLYRELYHKLKDKIHTTPDTPE
IRQVKKTQEAVSELIYKSDFFKMQGHMISLPYTPQVIHCRYVGDITSDIKYKEDLQVLKG
FGCFLYDTPDMVRSRHLRKLWSNYLYTDKARKMRDKYKVVLDTPEYRKVQELKTHLSELV
YRAAGKKQKSIFTSVPDTPDLLRAKRGQKLQSQYLYVELATKERPHHHAGNQTTALKHAK
DVKDMVSEKKYKIQYEKMKDKYTPVPDTPILIRAKRAYWNASDLRYKETFQKTKGKYHTV
KDALDIVYHRKVTDDISKIKYKENYMSQLGIWRSIPDRPEHFHHRAVTDTVSDVKYKEDL
TWLKGIGCYAYDTPDFTLAEKNKTLYSKYKYKEVFERTKSDFKYVADSPINRHFKYATQL
MNEKKYRADYEQRKDKYHLVVDEPRHLLAKTAGDQISQIKYRKNYEKSKDKFTSIVDTPE
HLRTTKVNKQISDILYKLEYNKAKPRGYTTIHDTPMLLHVRKVKDEVSDLKYKEVYQRNK
SNCTIEPDAVHIKAAKDAYKVNTNLDYKKQYEANKAHWKWTPDRPDFLQAAKSSLQQSDF
EYKLDREFLKGCKLSVTDDKNTVLALRNTLIESDLKYKEKHVKERGTCHAVPDTPQILLA
KTVSNLVSENKYKDHVKKHLAQGSYTTLPETRDTVHVKEVTKHVSDTNYKKKFVKEKGKS
NYSIMLEPPEVKHAMEVAKKQSDVAYRKDAKENLHYTTVADRPDIKKATQAAKQASEVEY
RAKHRKEGSHGLSMLGRPDIEMAKKAAKLSSQVKYRENFDKEKGKTPKYNPKDSQLYKVM
KDANNLASEVKYKADLKKLHKPVTDMKESLIMNHVLNTSQLASSYQYKKKYEKSKGHYHT
IPDNLEQLHLKEATELQSIVKYKEKYEKERGKPMLDFETPTYITAKESQQMQSGKEYRKD
YEESIKGRNLTGLEVTPALLHVKYATKIASEKEYRKDLEESIRGKGLTEMEDTPDMLRAK
NATQILNEKEYKRDLELEVKGRGLNAMANETPDFMRARNATDIASQIKYKQSAEMEKANF
TSVVDTPEIIHAQQVKNLSSQKKYKEDAEKSMSYYETVLDTPEIQRVRENQKNFSLLQYQ
CDLKNSKGKITVVQDTPEILRVKENQKNFSSVLYKEDVSPGTAIGKTPEMMRVKQTQDHI
SSVKYKEAIGQGTPIPDLPEVKRVKETQKHISSVMYKENLGTGIPTTVTPEIERVKRNQE
NFSSVLYKENLGKGIPTPITPEMERVKRNQENFSSVLYKENMGKGTPLAVTPEMERVKHN
QENISSVLYKENVGKATATPVTPEMQRVKRNQENISSVLYKENLGKATPTPFTPEMERVK
RNQENFSSVLYKENMRKATPTPVTPEMERAKRNQENISSVLYSDSFRKQIQGKAAYVLDT
PEMRRVRETQRHISTVKYHEDFEKHKGCFTPVVTDPITERVKKNMQDFSDINYRGIQRKV
VEMEQKRNDQDQETITGLRVWRTNPGSVFDYDPAEDNIQSRSLHMINVQAQRRSREQSRS
ASALSISGGEEKSEHSEAPDHHLSTYSDGGVFAVSTAYKHAKTTELPQQRSSSVATQQTT
VSSIPSHPSTAGKIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGM
LPANYVEAI
NT seq 20010 nt   +upstreamnt  +downstreamnt
atggcagatgacgaagactatgaggaggtggtggagtactacacagaagaagtggtttac
gaagaggtgccgggagagacaataacaaaaatttatgagactacgacaacaaggacatct
gactatgagcaatcagaaacttccaaaccagctctggcacagccagcactggcacagcca
gcatcagcaaagccggtggagaggaggaaggtcatccggaagaaagtggatccttcaaag
ttcatgaccccctacattgcacacagtcagaaaatgcaggatctttttagcccaaataaa
tacaaggagaagtttgagaaaacaaaaggacagccatacgccagcacaacagatactcca
gaacttcgcagaatcaaaaaagtacaagatcaactcagtgaggttaagtatcgaatggat
ggtgatgttgctaagactatatgtcacgtagatgaaaaagcaaaggatattgaacatgca
aagaaagtgtcgcagcaagtcagtaaggttttatacaagcagaactgggaagacaccaag
gataagtacctgcttcctcctgatgcccctgaacttgtccaggccgttaagaacaccgcc
atgttcagcaagaaactgtacactgaagactgggaagcagacaaaagtttgttttacccc
tataatgatagcccggaactgaggagagttgcccaggcccagaaagctctcagtgatgtt
gcctacaaaaaaggtctcgctgaacagcaagctcaattcacgcctctggctgatcctcca
gatatagaatttgccaagaaagtaaccaatcaagtgagcaagcaaaaatacaaagaagac
tatgaaaataaaatcaaaggcaaatggagtgagacaccttgctttgaagttgcaaatgcc
agaatgaatgctgataacattagcacaaggaaataccaggaagattttgaaaacatgaaa
gaccagatctacttcatgcagaccgaaacaccagagtataaaatgaataaaaaagctggt
gtggcagctagcaaggtaaaatacaaagaagactatgaaaagaataaaggaaaagcagat
tataatgtgcttcctgcttcagagaacccacagcttaggcagctgaaggcagcaggagat
gccctaagtgacaaactatacaaggaaaactatgaaaagacaaaagcaaagagcataaat
tactgcgagacccccaaattcaagctcgatactgttctgcagaacttcagtagtgataaa
aaatataaagattcctacttaaaagatattttgggacattatgtaggcagcttcgaggat
ccataccattcacactgcatgaaagtcacagctcaaaacagtgataaaaactacaaagca
gaatacgaagaagacagaggcaaaggcttcttccctcagaccataactcaagaatatgaa
gcaattaagaaactagatcagtgtaaagaccacacctacaaagtccatccagataagaca
aaattcacccaagttacagactctcctgttctgctacaagcccaagtcaattccaaacaa
ctgagtgacttaaattacaaagcaaaacatgaaagtgaaaagttcaagtgccatatcccc
cctgatactcctgcttttatccagcacaaagtcaatgcctataacttgagtgataatctt
tataagcaagactgggagaagagcaaagccaaaaagtttgacattaaagtggatgccatt
cccctgctggcagccaaagccaacaccaagaacaccagcgatgtgatgtacaagaaagac
tatgaaaaaaacaaagggaaaatgattggagtcctcagcattaatgacgatcccaagatg
ctgcactccttgaaggtggccaaaaaccagagtgatagattatacaaggaaaactatgag
aagacaaaggcaaagagtatgaattactgtgagaccccaaaatatcaacttgatactcag
ctgaagaacttcagtgaggctagatataaagacttatatgtaaaggatgttttgggacat
tatgtaggcagcatggaggacccatatcacacacactgcatgaaagttgcagctcaaaac
agtgataaaagttacaaagcagaatatgaagaagataaaggaaaatgctatttccctcag
acaataacacaagaatatgaagcaatcaagaagctggaccagtgtaaagatcatacctac
aaagttcatccagataagaccaaattcacggcagtcactgattctcctgtactgttgcaa
gcccagctcaacacgaaacagcttagtgatctgaattacaaagcaaaacatgaaggtgag
aagttcaagtgccatataccagcagatgctccacagtttatccaacacagagtcaatgcc
tataatctgagtgataatgtttataagcaagactgggagaagagcaaagccaagaagttt
gacattaaagtggacgccattcccctgttggcagccaaagccaacaccaagaacaccagc
gatgtgatgtacaagaaagactatgaaaagagcaaagggaaaatgattggagccctcagc
attaatgacgatccaaagatgctgcactccttgaagacagccaaaaaccagagtgatcgc
gaatatcgaaaagattatgaaaagtcaaaaactatctacacggcacctcttgatatgctc
caagtcactcaagctaagaaatctcaggcaattgccagcgacgttgattataagcacatc
ttacacagttacagctacccccctgatagcatcaatgtggaccttgccaagaaggcatat
gcgctgcagagcgatgttgaatacaaagctgactacaatagctggatgaaaggttgtggc
tgggtgccttttgggtccttagaaatggaaaaggcaaagcgagcttcagacatcctcaat
gagaaaaaatatcgccaacatccagacaccctcaagtttacctcgattgaagatgctcca
attacagtacagtctaaaattaaccaggcccagaggagtgatatcgcttacaaagccaaa
ggagaggaaattattcacaaatacaacctgccaccagacctgccccagttcatccaggct
aaagttaatgcctacaatatcagtgagaatatgtacaaagcagacttgaaagacttgagc
aagaagggatatgacctgagaactgatgcgattcccatcagagctgccaaagctgccagg
caggcggcgagtgacgttcagtacaaaaaagactatgaaaaggctaaagggaaaatggtt
ggcttccaaagtcttcaagatgaccctaaactggttcattatatgaacgtggccaagata
caatcagatcgggagtataaaaaagactatgagaagacaaagtccaaatacaacacgccc
catgatatgttcaatgtcgtggcggctaagaaagcccaggatgtggtcagcaatgtcaac
tataagcattctctccatcattacacctacttgcctgacgccatggacctggagctgtct
aagaacatgatgcagatacagagtgataacgtctacaaggaagactacaacaactggatg
aaaggcattggctggattcctattggcagtctcgacgtcgaaaaagttaaaaaggccggt
gatgctctgaatgaaaagaagtacaggcaacatccagacaccctcaaatttaccagcatt
gtggactccccagttatggtccaggcaaaacagaacacgaagcaagtcagtgatatctta
tacaaggctaaaggagaagatgtgaaacataaatacaccatgagtcctgatcttcctcag
tttctccaggccaagtgcaatgcttacaatataagtgacgtctgttataaacgggattgg
tatgacttaatagccaagggcaacaatgtgctgggcgatgctattcccatcactgcagcc
aaggcatcgagaaacattgccagtgattataaatacaaggaagcttatgagaagtcaaag
ggaaagcatgtgggtttcagaagcctccaggatgatcccaagctggtccactatatgaat
gtggcaaagctgcagtctgatcgtgaatacaagaagaactatgagaacaccaaaaccagc
taccatacccctggggacatggttagcatcacagctgcaaagatggcccaggatgtcgct
accaatgtcaactacaaacagccattgcatcattacacatacctacctgacgccatgagt
cttgagcatacgaggaatgtcaatcaaattcagagtgataatgtgtataaagacgagtat
aacagcttcttgaagggcatcggatggatccctattggttccctggaggtggagaaggtc
aagaaagcaggcgatgcattaaatgagaggaagtatcgacagcacccagataccgtcaag
ttcacaagtgtgcctgattccatgggcatggtgttggctcagcataacacaaagcagcta
agtgatttgaactacaaggtagagggagagaaactgaagcacaagtatactattgaccct
gaattgcctcagtttattcaagccaaagtcaacgccctcaacatgagtgatgctcattat
aaagcagattggaagaaaaccattgccaagggctatgatttgagaccagatgccatccca
attgttgctgcaaaaagttcaaggaatattgctagtgattgcaaatataaggaggcctac
gagaaagccaaaggcaagcaagttggatttctcagtcttcaggatgatcctaaactggtt
cactacatgaatgtggccaaaatccagtctgatcgtgagtacaaaaagggctatgaagcc
agcaagaccaagtaccacacacctctggatatggtcagtgtgacagctgcaaagaaatct
caggaggttgccaccaacgccaactacagacagtcataccaccactacactctcctgccc
gatgccttgaatgtggagcactccaggaatgccatgcagattcagagtgataatctgtac
aaatctgacttcaccaattggatgaaagggatcggctgggtgcccatagagtccctggag
gtggagaaggcaaagaaagcaggagagattcttagtgagaagaagtatcgccagcacccc
gagaagctgaagttcacttacgccatggacacaatggaacaggcacttaacaagagtaac
aaactgaacatggacaagaggctctacactgaaaaatggaacaaggacaagaccaccatt
catgtcatgcctgacacaccggatattttactctccagagtaaaccaaatcaccatgagt
gataaactgtacaaagctggctgggaagaggaaaagaagaaaggatatgacctgaggcct
gatgccattgcaataaaggctgcaagagcctctagagacattgccagtgattacaaatac
aagaaagcctatgaacaagccaaagggaaacacattggcttccggagcctggaagatgac
cccaagctggtgcacttcatgcaagtggccaagatgcagtcagaccgggaatacaagaag
ggatatgagaaatccaagacctccttccacaccccggtggacatgctcagtgtggtggca
gccaagaagtctcaggaagtggccaccaatgccaactacaggaacgtgatccatacctac
aacatgcttcctgatgccatgagctttgaattggccaaaaatatgatgcagattcaaagt
gataatcagtacaaggctgactatgctgacttcatgaagggcattggatggctccctctg
ggctccctggaagcagagaaaaacaagaaagccatggagattattagtgaaaagaagtac
cgccagcacccagacactttgaagtattccacactcatggactcgatgaacatggttttg
gcccagaataatgcaaaaattatgaacgaacatctctacaaacaagcatgggaggctgac
aaaaccaaagtccacatcatgcctgatatcccccagattattttggcaaaggcaaatgca
attaatatgagtgataaactctacaaactttccttggaagagtctaaaaagaaaggctat
gatctcagacctgatgcaattcctatcaaagctgccaaggcttccagagatattgcaagt
gattataaatacaagtacaattatgaaaaagggaaggggaaaatggttggtttccgcagt
ctcgaggatgatcccaaattagtccattccatgcaagtggctaagatgcaatctgatcgg
gagtacaagaaaaactatgagaacacaaagaccagctaccacacccctgccgacatgctc
agtgtcacggctgcaaaggatgcccaagccaacatcaccaacactaactacaagcacctg
attcacaagtacatcctccttccagatgcaatgaacattgagctgaccaggaatatgaat
cgcatacagagtgataatgaatataagcaagattacaatgaatggtacaaagggcttggc
tggagtccagcaggttctctggaagtggagaaggccaagaaagcaactgaatatgccagt
gatcagaaataccgccagcacccgagcaacttccagtttaagaagctgactgattccatg
gacatggtgcttgccaagcagaatgcacataccatgaacaagcatttatacaccattgat
tggaataaagataagaccaagattcatgtgatgcctgatacaccagatattttacaagcc
aagcagaatcaaacactgtatagtcagaaactctataaacttggatgggaagaagctttg
aagaaaggctatgatctcccagttgatgcaatttctgtacagctagctaaagcttcaaga
gacattgctagtgattataaatacaaacaaggctaccgaaagcaacttggccaccatgtt
ggattccggagtctgcaagatgacccaaaacttgtgttgtccatgaatgtagccaaaatg
cagagtgaaagagaatacaagaaggactttgagaagtggaaaactaagttctccagccca
gtggacatgttgggagtggtactggccaagaagtgtcaggagttggttagtgacgtggac
tacaagaactacctgcatcagtggacatgtctgcctgatcagaacgatgttgtgcaagct
aagaaagtttatgaactgcaaagtgagaatctatataaatctgaccttgagtggctgaga
ggcataggatggagtcccttgggttctttagaggcagaaaagaacaagcgggcttcggaa
atcatcagtgagaagaaatatcgtcagcctccagacagaaacaagttcaccagcattcct
gatgccatggatatagttctggcaaagacaaatgccaaaaataggagtgatagactttat
agagaagcttgggacaaagacaagactcagatccacatcatgcctgatacacctgacatt
gttctggctaaagcaaacttaatcaacacaagtgataaactctaccgaatgggttatgag
gagctgaagagaaaaggttacgatcttcctgttgatgccataccaatcaaagcagcaaaa
gcctcccgggaaattgccagtgaatacaagtacaaggaaggctttcgcaagcagctcggc
caccacattggtgcccggaacattgaagatgaccccaagatgatgtggtccatgcatgtg
gccaagatccagagtgacagggagtacaagaaggactttgagaagtggaagaccaagttc
agcagcccagtggacatgctgggggtggtgttggccaagaagtgccagaccttagtcagc
gacgtggactacaagaactacctgcaccagtggacatgcctgcccgaccagagcgatgtc
atccatgctcggcaggcctatgacctccagagcgataatttgtacaagtcagaccttcag
tggctaaaaggcattggctggatgactagtggttctctcgaggatgagaaaaataaacga
gccacccagattttgagtgaccatgtttaccgtcagcacccagatcaatttaagttttcc
agccttatggattccataccaatggttttggcaaaaaacaatgctattaccatgaatcat
cgcctctatacagaagcttgggataaagataaaaccactgtccacattatgccagatacc
cctgaagttttattagctaaacaaaacaaagtaaattacagtgagaaattgtataagctt
ggcctagaagaagccaagaggaaaggttatgacatgcgggtagatgccattcctatcaag
gcagccaaggcctccagagatattgcaagtgaattcaagtacaaagaaggctatcgtaag
cagctcggccaccacattggtgcccgagctatacgtgatgaccccaagatgatgtggtcc
atgcacgtggccaagatccagagtgacagggagtacaagaaggactttgagaagtggaag
accaagttcagcagcccagtggacatgctgggggtggtgctggccaagaagtgccagacc
ttagtcagcgatgtggactacaagaactacctgcaccagtggacatgcctgcccgaccag
agcgacgtcatccatgctcggcaggcctatgacctccagagcgataatatgtacaagtct
gatctccagtggatgagaggcattggctgggtgtccattggctctttggatgtggaaaaa
tgcaaaagggcaactgaaattttgagtgataaaatctatcgccagcctccagacagattc
aaatttaccagtgtgactgactctctggaacaagtgctggccaagaacaatgctctcaac
atgaataagcgtttatacacagaggcctgggacaaagacaagactcaaattcacataatg
cctgatacaccagagattatgttggcaaggcagaacaaaatcaactacagtgagactcta
tacaaacttgccaatgaagaagcaaaaaagaaaggctacgacttgcgaagtgacgccatc
cccatcgtggctgccaaggcctccagggacgttatcagtgattacaaatacaaagatggt
taccgcaagcagctcggccaccacattggagcccggaacattgaagatgaccccaagatg
atgtggtccatgcatgtggccaagatccagagtgacagggagtataagaaggactttgag
aagtggaagaccaagttcagcagcccagtggacatgctgggagtggtgttagccaagaag
tgccagaccttagtcagcgatgtggactacaagaactacctgcacgagtggacgtgcctg
cccgaccagaatgatgtcatccatgctcggcaggcctatgacctccagagcgataacatt
tacaaatctgatctccagtggctgagaggcattggctgggtccccattgggtctatggat
gtggtcaagtgcaagagagctgctgaaatactgagtgataacatctaccgccagcctccg
gacaagctgaaatttaccagtgtgactgactctctagagcaggtgctggccaagaacaat
gctctcaatatgaacaagcgcttatacacagaagcctgggacaaagacaagacccaagtc
catattatgcctgatacacctgaaatcatgttggcaagacaaaataaaataaattatagt
gagagcctctatcgtcaggccatggaagaagccaagaaagaaggctatgacttgagaagt
gatgccattcccattgtggctgccaaggcctctcgggatattgccagtgattacaaatac
aaagaagcatatcgtaaacagttgggtcaccacattggcgcccgagcagtacacgatgac
cccaagataatgtggtccctccacattgccaaagtgcagagtgaccgtgagtacaagaaa
gattttgagaaatacaagacaaggtacagcagcccagtggacatgcttggtatcgttttg
gccaagaagtgtcagaccttggtcagcgatgtggactataaacatcctctgcatgaatgg
atctgcctgcccgaccagaatgacatcattcatgcacggaaagcctatgacctccagagt
gacaatttgtataagtcagaccttgaatggatgaaaggcattggctgggttccgattgat
tccttggaagttgttagggccaagagagctggagaattacttagtgatactatctaccgt
cagcgtccagaaacgctgaaatttaccagtataacggacactccggagcaggtgctggca
aaaaacaatgctttaaacatgaataagcgcttatatactgaagcctgggacaatgacaag
aaaactattcatgtcatgcctgatacaccagaaatcatgttagccaaactcaaccgaata
aactacagtgataaactctataaacttgctttggaagagtccaagaaggaaggctatgac
ttgcgtctggatgccattccaatccaagcagccaaggcttcaagagatattgctagtgat
tacaagtacaaggaaggctaccgcaaacagcttggccaccatattggggcccggaacatt
aaggatgacccgaagatgatgtggtccatccatgtggccaagatccagagtgacagggag
tacaagaaggagtttgagaagtggaagaccaagttcagcagcccagtggacatgctgggg
gtggtgctggccaagaagtgtcagatccttgtaagcgacatagactacaagcatcccctg
catgaatggacctgcctgcctgatcagaatgacgtcattcaggctcggaaggcctatgac
ctgcagagtgatgctatttacaaatctgatcttgagtggctgagaggcataggatgggtt
cccattggctctgtagaggtcgagaaagtgaagagagctggagaaatcctgagtgacagg
aagtatcgccagcctgcagaccagctcaaattcacatgcattaccgacactccggaaatt
gtcctagcaaagaataatgccctgacaatgagcaagcatttatacacagaagcttgggat
gctgacaaaacctccatccacgtgatgccagacaccccagatatcctgctggccaagagt
aattctgccaatatcagccaaaaactttacaccaagggatgggatgaatcaaagatgaag
gactatgatctgagagcagatgctatttccatcaaaagtgccaaggcctccagggacatc
gccagtgactacaaatacaaggaagcctatgagaaacagaaaggccaccacattggagcc
cagagcattgaagatgatcccaagattatgtgtgccatacatgcaggaaaaattcaaagt
gaaagggagtacaagaaggaattccaaaagtggaaaaccaagttctctagcccagtggac
atgttaagcatcttgctggccaagaaatgtcagactttggtcactgacattgattatcgc
aattacctgcatgaatggacatgcatgccggatcaaaacgacattatccaagcaaaaaag
gcctatgacctgcagagtgatgccctctacaaggctgacttggagtggttgcgtggcatt
ggctggatgccccaagggtctcctgaagtgttgagagtcaaaaacgcccagaatatcttt
tgtgacagtgtctatcggacgcctgtggtgaaccttaagtacacaagcattgttgacaca
cctgaagtggtccttgctaaatcaaatgctgaaaatattagtattccaaagtacagagag
gtttgggacaaggataaaacttcaatacacataatgccagatactccagaaattaatctc
gctagagcaaatgctcttaatgtgagcaataaactttaccgtgagggctgggatgaaatg
aaggcgggctgtgatgtccggctggatgccatccccatccaggctgccaaggcctccagg
gagattgccagtgactataaatataagcttgaccatgagaagcagaagggacactacgtg
ggcaccctcacagccagggatgacaacaagatccgctgggccctcatagctgacaagctc
cagaatgaacgagagtaccggctggactgggccaaatggaaggccaagatccagagccct
gtggacatgctttccatcctgcactctaaaaattcccaggctctggtcagtgacatggat
taccgcaattacctgcaccagtggacctgcatgcccgaccagaacgatgtgattcaggcc
aagaaggcctacgaactgcagagcgataatgtttacaaggctgacttggaatggttgcgt
ggaattgggtggatgccaaatgactccgtgtccgtcaatcatgccaaacatgccgcggac
atcttcagtgagaaaaaatatcgcacaaaaatagaaactctcaactttacgcctgtggat
gacagagttgattatgtgacagcgaaacaaagtggcgagatcctcgatgatattaaatac
cggaaagactggaatgccaccaaatcaaagtacaccctcacagaaacccccctgctgcac
actgcccaggaggctgctaggatactggaccagtatctctacaaggaaggctgggagaga
caaaaagccacaggttacattttgcctccagatgctgtgccatttgttcatgcccatcac
tgcaatgacgttcagagtgagctgaaatacaaagctgaacatgtgaagcaaaaaggtcat
tatgttggtgtcccgacgatgagagatgatcctaagctggtttggtttgagcatgcaggc
cagattcagaatgagagactatacaaagaggactatcacaaaacaaaggccaaaatcaat
atacctgctgatatggtgtcagtcttggccgccaagcaggggcagacccttgtcagtgat
attgattatcgtaattacttgcaccaatggatgtgtcatcctgaccagaacgatgttatt
caggcaagaaaggcctatgacctacagagtgataatgtctacagagctgacctggagtgg
ctccgaggcattggctggatcccactggattctgtggaccatgtaagggttactaagaac
caggaaatgatgagtcagatcaaatataagaaaaatgcccttgaaaactatcctaacttt
agaagtgtggtggatcctccagagattgttttagccaagattaattctgtcaatcaaagt
gatgtaaaatataaagaaacatttaataaagcaaagggcaaatatacgttttcaccagat
acaccacatatctcccactccaaagacatgggaaaactctacagtactatactgtataaa
ggggcgtgggagggcaccaaggcctatggctacaccctggatgagcgctacattcccatt
gttggagccaagcatgctgatctggtgaacagtgagcttaaatacaaagagacatatgag
aagcagaaaggtcactacctggctggaaaagtgatcggtgaattccctggtgtggttcac
tgtctggatttccaaaagatgaggagtgcgttgaactacagaaaacattatgaggatacc
aaagcaaatgttcatatccccaatgacatgatgaatcacgtgctggctaaaaggtgccag
tacatcctcagtgacctggagtatcgacactatttccaccagtggacgtctcttctggaa
gaacccaatgttatacgcgtccgaaacgcccaggagatcttgagtgataatgtgtataaa
gatgacctgaattggttgaaaggcattggttgctacgtttgggatacaccccaaatcctc
catgccaagaaatcatacgaccttcagagtcagctacaatatacagcagcaggtaaagaa
aatctacaaaactataatctggtcacagacacgcccctctatgtgactgctgttcagagt
ggcattaatgccagtgaggtaaaatataaagaaaattatcatcagattaaggacaaatac
acaacagttctagaaacagtggattatgacagaaccagaaacctgaagaatctttacagc
agtaacctgtacaaggaggcctgggatagagtgaaagccaccagctacatcctgccttcc
agcaccttgtccctgacacacgccaagaaccagaagcatctggccagccatatcaaatat
cgggaagaatatgaaaagttcaaagctctttatacgttaccaagaagtgttgacgatgat
ccgaacacagcacggtgcctccgagttggcaagcttaacatcgatcgcctgtacagatca
gtttatgaaaagaacaagatgaaaatccacatcgtgcccgacatggtagagatggttact
gccaaggattcccagaagaaagtcagtgagattgattaccgcctgcgcctccacgaatgg
atttgccaccccgacttgcaagtcaatgatcacgtcaggaaagtcacagatcagatcagc
gatattgtatacaaggatgacctcaactggctgaaaggcattggttgctacgtctgggac
actcctgaaatcctccatgccaagcatgcttatgatctacgtgatgatatcaagtataaa
gctcacatgttgaaaacaaggaatgactacaagcttgtcacagatacaccagtctacgtg
caggctgtcaaaagtgggaaacagctaagtgacgctgtctaccactatgactatgtgcac
agtgtcagaggcaaagtggctccaactaccaaaaccgtggatctggaccgggcccttcat
gcatacaagctccagagttcgaatctatacaaaaccagcctgcgcaccctgcccactgga
tatagacttccaggtgacactcctcacttcaaacacatcaaggacacccgttacatgagc
agttatttcaagtacaaagaagcctatgaacacaccaaggcatatgggtatacacttggc
cccaaagatgttccatttgtccacgtccggagagtcaacaatgttaccagcgagagactg
tatcgggaattgtaccacaaactgaaagacaagatccatacaactcccgatacccctgag
atccgccaagtcaagaagacacaagaggctgtcagtgagttgatctacaaatcagacttc
ttcaagatgcagggccacatgatctctctgccatacacaccccaagtgatccattgccgc
tatgtgggagacatcaccagtgatattaaatacaaagaggacttgcaggtcctgaaggga
tttggctgcttcctgtatgacactcctgacatggtccgctcccggcacctgcggaagctc
tggtctaattacctatacactgataaggcaaggaagatgcgagacaaatacaaagtggtg
cttgacactccagaatacagaaaagtgcaagaactgaagacacatctgagtgagctggtc
tacagagctgcaggcaagaagcagaagtcaatctttacttcagttcctgatactcctgat
cttttaagagccaagcgagggcagaagcttcagagtcagtatctgtatgttgaacttgcc
accaaagagagaccccatcatcacgctggaaaccagaccacagccttgaagcatgctaaa
gacgtgaaggacatggtcagtgagaaaaagtacaagattcaatatgaaaagatgaaagac
aagtacactccggttccagatacgccaatcctcatcagagccaagagggcttactggaat
gccagtgatctacgctacaaagaaacatttcaaaagaccaaagggaaataccacacggtg
aaagatgccctagacattgtctatcatcgcaaagtcacagatgacatcagtaaaataaaa
tacaaggagaactacatgagccagttgggtatctggaggtccattcctgatcgtccagag
catttccaccaccgagcagtcactgacacagtcagtgatgtaaaatataaagaagacttg
acttggcttaaaggcattggttgctatgcctatgatacccctgatttcactctggctgaa
aagaacaagactctctacagcaagtataagtataaagaagtatttgaaaggacaaagtca
gatttcaagtatgttgccgactctccgatcaataggcatttcaagtatgcaactcaattg
atgaatgagaaaaaatacagagctgattatgagcagcggaaagataaataccacctggta
gtcgatgagcctagacatctgctggctaagaccgcaggcgaccagatcagtcagatcaaa
tacaggaaaaactatgaaaaatcaaaggacaaatttacctcaattgtggatactccagaa
cacctgcgtactacaaaagtcaacaaacaaatcagcgatatcctttataaattggaatac
aacaaggccaaacccagaggctacaccacaatccacgacacacccatgttgctgcatgtc
cgcaaggttaaagatgaagtcagtgatctgaaatacaaagaagtataccaaagaaataaa
tccaactgcaccattgagccagatgctgttcatatcaaagcagccaaggacgcctacaaa
gtcaacaccaatctggactataagaaacagtacgaagccaacaaagcccactggaagtgg
actcctgaccgaccggacttcctccaggctgccaagtcatccctgcagcaaagcgatttt
gaatataagctggaccgggagttcctcaagggttgcaagctttctgtcactgatgacaaa
aacacggtgctcgccctcaggaatactttaatagaaagtgatctgaaatacaaagagaaa
catgtcaaggaaagaggaacctgccatgccgtacctgacacgcctcagatcctgctggcg
aagactgtcagcaacctggtgtctgagaacaagtacaaggaccatgtcaagaagcacttg
gcacagggctcatacacaacactaccagagacccgggacactgttcacgtcaaggaagtg
accaagcatgtcagtgatacaaattacaaaaagaagtttgtcaaggagaaaggaaaatcc
aactactccatcatgctggagccaccagaggtgaaacatgctatggaagtggccaagaag
caaagtgatgtcgcttacagaaaagatgccaaagagaacctgcattacaccacagtggct
gatcgaccagacatcaagaaggccacacaggcagccaaacaggccagtgaggtggagtac
agagccaagcaccgcaaggaaggcagccatggcttaagcatgctcggtcgcccagacata
gaaatggccaagaaggcagccaagctgagcagccaggttaaataccgagaaaatttcgat
aaagaaaagggcaagacaccaaaatacaatccaaaagacagccagctctacaaagtcatg
aaagatgctaataatcttgcaagtgaggttaaatacaaggctgacctgaagaaacttcac
aaacccgtgactgacatgaaggagtctctgatcatgaatcatgtcctgaatacaagccaa
cttgccagttcttaccagtacaagaagaagtatgagaagagtaaaggccactaccacacc
atacccgataatctggagcagcttcacctaaaagaggccacagaattacagagtatagtg
aaatacaaagaaaagtatgaaaaggaacgaggaaaacccatgctggactttgaaacacca
acgtacatcactgccaaagagtctcagcagatgcagagtgggaaagaatataggaaagat
tatgaagagtccattaaaggcagaaacctgactggcctggaggtcacgccagctttgtta
catgtcaaatatgcaactaaaatagcaagcgagaaagagtacaggaaagatctagaggaa
agcatccgtgggaagggcctcactgaaatggaagatacacctgacatgctaagagcaaag
aatgccactcaaatcctcaatgagaaagaatataagcgagacctggaactggaagtcaaa
ggaagaggcctgaatgccatggccaatgaaactccggattttatgagggccaggaatgct
actgatattgccagtcagattaagtataagcaatcagcagaaatggagaaagccaatttc
acttctgtggttgatactccagagatcattcatgcccaacaagtcaagaatctttcaagc
cagaaaaagtacaaggaagatgctgagaagtccatgtcgtattatgagactgttttggac
accccagagatacagagagtccgggagaaccaaaagaacttcagccttctccaataccag
tgtgaccttaaaaacagtaaaggaaaaattacagttgttcaagacacgccagaaatactg
cgtgtaaaagaaaatcagaagaatttcagctcggttttatataaagaggatgtctcacca
ggaacggctatcggaaagacacctgagatgatgagagtgaaacaaacacaggaccacatt
agctcggtgaagtataaggaagcaataggacaaggaactccaatccctgacctgcctgaa
gtgaaacgtgtgaaggagacgcagaagcacattagctcggttatgtacaaagaaaacttg
ggaacaggcattccaaccactgtgactccagagattgagagagtcaaacgcaatcaagag
aactttagctcggttttgtacaaagaaaatttggggaaaggaatcccaacacctatcact
ccagagatggagagagtcaaacgcaatcaagagaactttagctcggtgttatacaaagaa
aacatgggcaagggaactcctttagctgtcactcccgagatggagcgagtcaaacacaat
caagaaaatattagctcggttttgtacaaagaaaatgtggggaaagccaccgcaacccct
gtcactcctgagatgcagagagtcaaacgcaatcaagaaaacattagctcggtgttatac
aaagagaacctggggaaagcaacccccacaccctttactcctgagatggaaagagtgaaa
cgcaatcaagaaaactttagctcggtattgtacaaagagaacatgagaaaagcaactccg
acacctgttactccagagatggagagagctaagcgcaaccaagaaaacattagctcggtt
ctttattctgatagtttccggaaacaaatacaaggcaaagctgcctatgtattggatacc
cccgagatgagacgggtgagggagacccaacggcacatctcaacggtgaaatatcatgaa
gactttgagaaacacaagggttgcttcacaccagtggtgacagatcctatcactgaacga
gtaaagaagaacatgcaggacttcagtgacattaactaccgaggtattcagaggaaagtg
gtagaaatggaacaaaaacggaatgaccaagatcaggagactattacaggtttacgtgtc
tggcgtactaatcctggttcggtttttgactatgatccagcagaagacaacatccagtcc
cgaagcttacacatgattaatgtccaagctcagcgccggagccgggagcagtcacgatct
gccagtgcactaagcatcagtgggggtgaggagaagtctgagcattcagaagcaccagac
caccacctttcgacttacagcgacgggggtgtctttgcagtctcaacagcttacaaacat
gcaaaaaccacagagctcccacaacaacgatcatcttcagttgctacccaacagacaacg
gtatcttccatcccatctcatccatctactgctggaaaaatcttccgtgccatgtatgac
tatatggctgctgatgcagatgaggtgtccttcaaggatggagatgccatcataaatgtt
caagcaattgatgaaggctggatgtatggcactgtgcagaggactggcaggaccggaatg
ctcccagccaactacgttgaagctatttag

DBGET integrated database retrieval system