KEGG   Homo sapiens (human): 4791Help
Entry
4791              CDS       T01001                                 

Gene name
NFKB2, CVID10, H2TF1, LYT-10, LYT10, NF-kB2, p100, p49/p100, p52
Definition
(RefSeq) nuclear factor kappa B subunit 2
  KO
K04469  nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa05134  Legionellosis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05224  Breast cancer
Network
N00505  CD40-NFKB signaling pathway
N00506  HTLV-1 Tax to CD40-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4791 (NFKB2)
   04064 NF-kappa B signaling pathway
    4791 (NFKB2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4791 (NFKB2)
  09158 Development
   04380 Osteoclast differentiation
    4791 (NFKB2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    4791 (NFKB2)
   05203 Viral carcinogenesis
    4791 (NFKB2)
  09162 Cancers: Specific types
   05224 Breast cancer
    4791 (NFKB2)
  09171 Infectious diseases: Bacterial
   05134 Legionellosis
    4791 (NFKB2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    4791 (NFKB2)
   05169 Epstein-Barr virus infection
    4791 (NFKB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4791 (NFKB2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    4791 (NFKB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank Ank_3 Ank_5 Ank_4 Death
Motif
Other DBs
NCBI-GeneID: 4791
NCBI-ProteinID: NP_001070962
OMIM: 164012
HGNC: 7795
Ensembl: ENSG00000077150
Vega: OTTHUMG00000018962
Pharos: Q00653(Tchem)
UniProt: Q00653
Structure
PDB: 

Position
10q24.32
AA seq 900 aa AA seqDB search
MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN
VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGP
EKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggagagttgctacaacccaggtctggatggtattattgaatatgatgatttcaaattg
aactcctccattgtggaacccaaggagccagccccagaaacagctgatggcccctacctg
gtgatcgtggaacagcctaagcagagaggcttccgatttcgatatggctgtgaaggcccc
tcccatggaggactgcccggtgcctccagtgagaagggccgaaagacctatcccactgtc
aagatctgtaactacgagggaccagccaagatcgaggtggacctggtaacacacagtgac
ccacctcgtgctcatgcccacagtctggtgggcaagcaatgctcggagctggggatctgc
gccgtttctgtggggcccaaggacatgactgcccaatttaacaacctgggtgtcctgcat
gtgactaagaagaacatgatggggactatgatacaaaaacttcagaggcagcggctccgc
tctaggccccagggccttacggaggccgagcagcgggagctggagcaagaggccaaagaa
ctgaagaaggtgatggatctgagtatagtgcggctgcgcttctctgccttccttagagcc
agtgatggctccttctccctgcccctgaagccagtcatctcccagcccatccatgacagc
aaatctccgggggcatcaaacctgaagatttctcgaatggacaagacagcaggctctgtg
cggggtggagatgaagtttatctgctttgtgacaaggtgcagaaagatgacattgaggtt
cggttctatgaggatgatgagaatggatggcaggcctttggggacttctctcccacagat
gtgcataaacagtatgccattgtgttccggacacccccctatcacaagatgaagattgag
cggcctgtaacagtgtttctgcaactgaaacgcaagcgaggaggggacgtgtctgattcc
aaacagttcacctattaccctctggtggaagacaaggaagaggtgcagcggaagcggagg
aaggccttgcccaccttctcccagcccttcgggggtggctcccacatgggtggaggctct
gggggtgcagccgggggctacggaggagctggaggaggtggcagcctcggtttcttcccc
tcctccctggcctacagcccctaccagtccggcgcgggccccatgggctgctacccggga
ggcgggggcggggcgcagatggccgccacggtgcccagcagggactccggggaggaagcc
gcggagccgagcgccccctccaggaccccccagtgcgagccgcaggccccggagatgctg
cagcgagctcgagagtacaacgcgcgcctgttcggcctggcgcagcgcagcgcccgagcc
ctactcgactacggcgtcaccgcggacgcgcgcgcgctgctggcgggacagcgccacctg
ctgacggcgcaggacgagaacggagacacaccactgcacctagccatcatccacgggcag
accagtgtcattgagcagatagtctatgtcatccaccacgcccaggacctcggcgttgtc
aacctcaccaaccacctgcaccagacgcccctgcacctggcggtgatcacggggcagacg
agtgtggtgagctttctgctgcgggtaggtgcagacccagctctgctggatcggcatgga
gactcagccatgcatctggcgctgcgggcaggcgctggtgctcctgagctgctgcgtgca
ctgcttcagagtggagctcctgctgtgccccagctgttgcatatgcctgactttgaggga
ctgtatccagtacacctggcggtccgagcccgaagccctgagtgcctggatctgctggtg
gacagtggggctgaagtggaggccacagagcggcaggggggacgaacagccttgcatcta
gccacagagatggaggagctggggttggtcacccatctggtcaccaagctccgggccaac
gtgaacgctcgcacctttgcgggaaacacacccctgcacctggcagctggactggggtac
ccgaccctcacccgcctccttctgaaggctggtgctgacatccatgctgaaaacgaggag
cccctgtgcccactgccttcaccccctacctctgatagcgactcggactctgaagggcct
gagaaggacacccgaagcagcttccggggccacacgcctcttgacctcacttgcagcacc
aaggtgaagaccttgctgctaaatgctgctcagaacaccatggagccacccctgaccccg
cccagcccagcagggccgggactgtcacttggtgatacagctctgcagaacctggagcag
ctgctagacgggccagaagcccagggcagctgggcagagctggcagagcgtctggggctg
cgcagcctggtagacacgtaccgacagacaacctcacccagtggcagcctcctgcgcagc
tacgagctggctggcggggacctggcaggtctactggaggccctgtctgacatgggccta
gaggagggagtgaggctgctgaggggtccagaaacccgagacaagctgcccagcacagca
gaggtgaaggaagacagtgcgtacgggagccagtcagtggagcaggaggcagagaagctg
ggcccaccccctgagccaccaggagggctctgccacgggcacccccagcctcaggtgcac
tga

DBGET integrated database retrieval system