KEGG   Homo sapiens (human): 4793Help
Entry
4793              CDS       T01001                                 

Gene name
NFKBIB, IKBB, TRIP9
Definition
(RefSeq) NFKB inhibitor beta
  KO
K02581  NF-kappa-B inhibitor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05131  Shigellosis
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05164  Influenza A
hsa05169  Epstein-Barr virus infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4793 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    4793 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    4793 (NFKBIB)
   04660 T cell receptor signaling pathway
    4793 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    4793 (NFKBIB)
   04659 Th17 cell differentiation
    4793 (NFKBIB)
   04662 B cell receptor signaling pathway
    4793 (NFKBIB)
   04062 Chemokine signaling pathway
    4793 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    4793 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4793 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4793 (NFKBIB)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    4793 (NFKBIB)
  09172 Infectious disease: viral
   05162 Measles
    4793 (NFKBIB)
   05164 Influenza A
    4793 (NFKBIB)
   05169 Epstein-Barr virus infection
    4793 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    4793 (NFKBIB)
   05140 Leishmaniasis
    4793 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4793 (NFKBIB)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    4793 (NFKBIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5
Motif
Other DBs
NCBI-GeneID: 4793
NCBI-ProteinID: NP_002494
OMIM: 604495
HGNC: 7798
Ensembl: ENSG00000104825
Vega: OTTHUMG00000177631
Pharos: Q15653(Tbio)
UniProt: Q15653
Position
19q13.2
AA seq 356 aa AA seqDB search
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGL
CVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALY
PDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC
GRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPE
PEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctggggtcgcgtgcttgggaaaagctgccgacgcagatgaatggtgcgacagcggc
ctgggctccctgggtccggacgcagcggcccccggaggacctgggttgggcgcggagttg
ggcccggggctgtcgtgggctcccctcgtcttcggctacgtcactgaggatggggacacg
gcactgcacttggctgtgattcatcagcatgaacccttcctggattttcttctaggcttc
tcggccggcactgagtacatggacctgcagaatgacctaggccagacagccctgcacctg
gcagccatcctgggggagacatccacggtggagaagctgtacgcagcaggcgccgggctg
tgtgtggcggagcgtaggggccacacggcgctgcacctggcctgccgtgtgggggcacac
gcctgtgcccgtgccctgcttcagccccgcccccggcgccccagggaagcccccgacacc
tacctcgctcagggccctgaccgtactcccgacaccaaccatacccctgtcgccttgtac
cccgattccgacttggagaaggaagaagaggagagtgaggaggactggaagctgcagctg
gaggctgaaaactacgagggccacaccccactccacgtggccgttatccacaaagatgtg
gagatggtccggctgctccgagatgctggagctgaccttgacaaaccggagcccacgtgc
ggccggagcccccttcatttggcagtggaggcccaggcagccgatgtgctggagcttctc
ctgagggcaggcgcgaaccctgctgcccgcatgtacggtggccgcaccccactcggcagt
gccatgctccggcccaaccccatcctcgcccgcctcctccgtgcacacggagcccctgag
cccgagggcgaggacgagaaatccggcccctgcagcagcagtagcgacagcgacagcgga
gacgagggcgatgaatacgacgacattgtggttcacagcagccgcagccaaacccggctg
cctcccaccccagcctcaaaacctcttcctgacgacccccgccccgtgtga

DBGET integrated database retrieval system