KEGG   Homo sapiens (human): 4846Help
Entry
4846              CDS       T01001                                 

Gene name
NOS3, ECNOS, eNOS
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04611  Platelet activation
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05418  Fluid shear stress and atherosclerosis
Disease
H01529  Avascular necrosis of femoral head
Drug target
Pimagedine hydrochloride: D05479
Tilarginine acetate: D09018
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    4846 (NOS3)
   00330 Arginine and proline metabolism
    4846 (NOS3)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    4846 (NOS3)
   04371 Apelin signaling pathway
    4846 (NOS3)
   04066 HIF-1 signaling pathway
    4846 (NOS3)
   04020 Calcium signaling pathway
    4846 (NOS3)
   04071 Sphingolipid signaling pathway
    4846 (NOS3)
   04022 cGMP - PKG signaling pathway
    4846 (NOS3)
   04151 PI3K-Akt signaling pathway
    4846 (NOS3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    4846 (NOS3)
  Endocrine system
   04915 Estrogen signaling pathway
    4846 (NOS3)
   04921 Oxytocin signaling pathway
    4846 (NOS3)
   04926 Relaxin signaling pathway
    4846 (NOS3)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4846 (NOS3)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    4846 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    4846 (NOS3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     4846 (NOS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Motif
Other DBs
NCBI-GeneID: 4846
NCBI-ProteinID: NP_000594
OMIM: 163729
HGNC: 7876
Ensembl: ENSG00000164867
Vega: OTTHUMG00000158343
Pharos: P29474(Tchem)
UniProt: P29474
Structure
PDB: 

Position
7q36.1
AA seq 1203 aa AA seqDB search
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP
EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDDPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtggcccaggagcctgggccaccctgcggcctggggctgggg
ctgggccttgggctgtgcggcaagcagggcccagccaccccggcccctgagcccagccgg
gccccagcatccctactcccaccagcgccagaacacagccccccgagctccccgctaacc
cagcccccagaggggcccaagttccctcgtgtgaagaactgggaggtggggagcatcacc
tatgacaccctcagcgcccaggcgcagcaggatgggccctgcaccccaagacgctgcctg
ggctccctggtatttccacggaaactacagggccggccctcccccggccccccggcccct
gagcagctgctgagtcaggcccgggacttcatcaaccagtactacagctccattaagagg
agcggctcccaggcccacgaacagcggcttcaagaggtggaagccgaggtggcagccaca
ggcacctaccagcttagggagagcgagctggtgttcggggctaagcaggcctggcgcaac
gctccccgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggac
tgcaggtctgcacaggaaatgttcacctacatctgcaaccacatcaagtatgccaccaac
cggggcaaccttcgctcggccatcacagtgttcccgcagcgctgccctggccgaggagac
ttccgaatctggaacagccagctggtgcgctacgcgggctaccggcagcaggatggctct
gtgcggggggacccagccaacgtggagatcaccgagctctgcattcagcacggctggacc
ccaggaaacggtcgcttcgacgtgctgcccctgctgctgcaggccccagatgatccccca
gaactcttccttctgccccccgagctggtccttgaggtgcccctggagcaccccacgctg
gagtggtttgcagccctgggcctgcgctggtacgccctcccggcagtgtccaacatgctg
ctggaaattgggggcctggagttccccgcagcccccttcagtggctggtacatgagcact
gagatcggcacgaggaacctgtgtgaccctcaccgctacaacatcctggaggatgtggct
gtctgcatggacctggatacccggaccacctcgtccctgtggaaagacaaggcagcagtg
gaaatcaacgtggccgtgctgcacagttaccagctagccaaagtcaccatcgtggaccac
cacgccgccacggcctctttcatgaagcacctggagaatgagcagaaggccagggggggc
tgccctgcagactgggcctggatcgtgccccccatctcgggcagcctcactcctgttttc
catcaggagatggtcaactatttcctgtccccggccttccgctaccagccagacccctgg
aaggggagtgccgccaagggcaccggcatcaccaggaagaagacctttaaagaagtggcc
aacgccgtgaagatctccgcctcgctcatgggcacggtgatggcgaagcgagtgaaggcg
acaatcctgtatggctccgagaccggccgggcccagagctacgcacagcagctggggaga
ctcttccggaaggcttttgatccccgggtcctgtgtatggatgagtatgacgtggtgtcc
ctcgaacacgagacgctggtgctggtggtaaccagcacatttgggaatggggatcccccg
gagaatggagagagctttgcagctgccctgatggagatgtccggcccctacaacagctcc
cctcggccggaacagcacaagagttataagatccgcttcaacagcatctcctgctcagac
ccactggtgtcctcttggcggcggaagaggaaggagtccagtaacacagacagtgcaggg
gccctgggcaccctcaggttctgtgtgttcgggctcggctcccgggcatacccccacttc
tgcgcctttgctcgtgccgtggacacacggctggaggaactgggcggggagcggctgctg
cagctgggccagggcgacgagctgtgcggccaggaggaggccttccgaggctgggcccag
gctgccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaggccgccgcc
cgagacatcttcagccccaaacggagctggaagcgccagaggtaccggctgagcgcccag
gccgagggcctgcagttgctgccaggtctgatccacgtgcacaggcggaagatgttccag
gctacaatccgctcagtggaaaacctgcaaagcagcaagtccacgagggccaccatcctg
gtgcgcctggacaccggaggccaggaggggctgcagtaccagccgggggaccacataggt
gtctgcccgcccaaccggcccggccttgtggaggcgctgctgagccgcgtggaggacccg
ccggcgcccactgagcccgtggcagtagagcagctggagaagggcagccctggtggccct
ccccccggctgggtgcgggacccccggctgcccccgtgcacgctgcgccaggctctcacc
ttcttcctggacatcacctccccacccagccctcagctcttgcggctgctcagcaccttg
gcagaagagcccagggaacagcaggagctggaggccctcagccaggatccccgacgctac
gaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccgtcg
gtggcgctgcctgccccactgctcctcacccagctgcctctgctccagccccggtactac
tcagtcagctcggcacccagcacccacccaggagagatccacctcactgtagctgtgctg
gcatacaggactcaggatgggctgggccccctgcactatggagtctgctccacgtggcta
agccagctcaagcccggagaccctgtgccctgcttcatccggggggctccctccttccgg
ctgccacccgatcccagcttgccctgcatcctggtgggtccaggcactggcattgccccc
ttccggggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccact
cccatgactttggtgttcggctgccgatgctcccaacttgaccatctctaccgcgacgag
gtgcagaacgcccagcagcgcggggtgtttggccgagtcctcaccgccttctcccgggaa
cctgacaaccccaagacctacgtgcaggacatcctgaggacggagctggctgcggaggtg
caccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgttaccatggca
accaacgtcctgcagaccgtgcagcgcatcctggcgacggagggcgacatggagctggac
gaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaagacattttc
gggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttttccttg
caggagcgtcagttgcggggcgcagtgccctgggcgttcgaccctcccggctcagacacc
aacagcccctga

DBGET integrated database retrieval system