KEGG   Homo sapiens (human): 4869Help
Entry
4869              CDS       T01001                                 

Gene name
NPM1, B23, NPM
Definition
(RefSeq) nucleophosmin 1
  KO
K11276  nucleophosmin 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4869 (NPM1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    Nucleoplasmins
     4869 (NPM1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     4869 (NPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoplasmin NPM1-C SDA1 Nop14 NOA36 TFIIF_alpha CDC45 SAPS
Motif
Other DBs
NCBI-GeneID: 4869
NCBI-ProteinID: NP_002511
OMIM: 164040
HGNC: 7910
Ensembl: ENSG00000181163
Vega: OTTHUMG00000130465
Pharos: P06748(Tbio)
UniProt: P06748 A0A0S2Z491
Structure
PDB: 

Position
5q35.1
AA seq 294 aa AA seqDB search
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaagattcgatggacatggacatgagccccctgaggccccagaactatcttttcggt
tgtgaactaaaggccgacaaagattatcactttaaggtggataatgatgaaaatgagcac
cagttatctttaagaacggtcagtttaggggctggtgcaaaggatgagttgcacattgtt
gaagcagaggcaatgaattacgaaggcagtccaattaaagtaacactggcaactttgaaa
atgtctgtacagccaacggtttcccttgggggctttgaaataacaccaccagtggtctta
aggttgaagtgtggttcagggccagtgcatattagtggacagcacttagtagctgtggag
gaagatgcagagtcagaagatgaagaggaggaggatgtgaaactcttaagtatatctgga
aagcggtctgcccctggaggtggtagcaaggttccacagaaaaaagtaaaacttgctgct
gatgaagatgatgacgatgatgatgaagaggatgatgatgaagatgatgatgatgatgat
tttgatgatgaggaagctgaagaaaaagcgccagtgaagaaatctatacgagatactcca
gccaaaaatgcacaaaagtcaaatcagaatggaaaagactcaaaaccatcatcaacacca
agatcaaaaggacaagaatccttcaagaaacaggaaaaaactcctaaaacaccaaaagga
cctagttctgtagaagacattaaagcaaaaatgcaagcaagtatagaaaaaggtggttct
cttcccaaagtggaagccaaattcatcaattatgtgaagaattgcttccggatgactgac
caagaggctattcaagatctctggcagtggaggaagtctctttaa

DBGET integrated database retrieval system