KEGG   Homo sapiens (human): 488Help
Entry
488               CDS       T01001                                 

Gene name
ATP2A2, ATP2B, DAR, DD, SERCA2
Definition
(RefSeq) ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2
  KO
K05853  Ca2+ transporting ATPase, sarcoplasmic/endoplasmic reticulum [EC:3.6.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04919  Thyroid hormone signaling pathway
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00715  Darier disease
H00755  Acrokeratosis verruciformis
Drug target
Mipsagargin: D10715
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    488 (ATP2A2)
   04024 cAMP signaling pathway
    488 (ATP2A2)
   04022 cGMP-PKG signaling pathway
    488 (ATP2A2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    488 (ATP2A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    488 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    488 (ATP2A2)
  09154 Digestive system
   04972 Pancreatic secretion
    488 (ATP2A2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    488 (ATP2A2)
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    488 (ATP2A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    488 (ATP2A2)
   05414 Dilated cardiomyopathy (DCM)
    488 (ATP2A2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     488 (ATP2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Motif
Other DBs
NCBI-GeneID: 488
NCBI-ProteinID: NP_733765
OMIM: 108740
HGNC: 812
Ensembl: ENSG00000174437
Vega: OTTHUMG00000169327
Pharos: P16615(Tbio)
UniProt: P16615 A0A0S2Z3L2
Position
12q24.11
AA seq 1042 aa AA seqDB search
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGV
KQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
NPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNVTQWLMVLKISLPVILMDETLKFVARNYLEPGKECVQPATKSCSFSACTDGISWPFVL
LIMPLVIWVYSTDTNFSDMFWS
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcgcacaccaagacggtggaggaggtgctgggccacttcggcgtcaacgag
agtacggggctgagcctggaacaggtcaagaagcttaaggagagatggggctccaacgag
ttaccggctgaagaaggaaaaaccttgctggaacttgtgattgagcagtttgaagacttg
ctagttaggattttattactggcagcatgtatatcttttgttttggcttggtttgaagaa
ggtgaagaaacaattacagcctttgtagaaccttttgtaattttactcatattagtagcc
aatgcaattgtgggtgtatggcaggaaagaaatgctgaaaatgccatcgaagcccttaag
gaatatgagcctgaaatgggcaaagtgtatcgacaggacagaaagagtgtgcagcggatt
aaagctaaagacatagttcctggtgatattgtagaaattgctgttggtgacaaagttcct
gctgatataaggttaacttccatcaaatctaccacactaagagttgaccagtcaattctc
acaggtgaatctgtctctgtcatcaagcacactgatcccgtccctgacccacgagctgtc
aaccaagataaaaagaacatgctgttttctggtacaaacattgctgctgggaaagctatg
ggagtggtggtagcaactggagttaacaccgaaattggcaagatccgggatgaaatggtg
gcaacagaacaggagagaacaccccttcagcaaaaactagatgaatttggggaacagctt
tccaaagtcatctcccttatttgcattgcagtctggatcataaatattgggcacttcaat
gacccggttcatggagggtcctggatcagaggtgctatttactactttaaaattgcagtg
gccctggctgtagcagccattcctgaaggtctgcctgcagtcatcaccacctgcctggct
cttggaactcgcagaatggcaaagaaaaatgccattgttcgaagcctcccgtctgtggaa
acccttggttgtacttctgttatctgctcagacaagactggtacacttacaacaaaccag
atgtcagtctgcaggatgttcattctggacagagtggaaggtgatacttgttcccttaat
gagtttaccataactggatcaacttatgcacctattggagaagtgcataaagatgataaa
ccagtgaattgtcaccagtatgatggtctggtagaattagcaacaatttgtgctctttgt
aatgactctgctttggattacaatgaggcaaagggtgtgtatgaaaaagttggagaagct
acagagactgctctcacttgcctagtagagaagatgaatgtatttgataccgaattgaag
ggtctttctaaaatagaacgtgcaaatgcctgcaactcagtcattaaacagctgatgaaa
aaggaattcactctagagttttcacgtgacagaaagtcaatgtcggtttactgtacacca
aataaaccaagcaggacatcaatgagcaagatgtttgtgaagggtgctcctgaaggtgtc
attgacaggtgcacccacattcgagttggaagtactaaggttcctatgacctctggagtc
aaacagaagatcatgtctgtcattcgagagtggggtagtggcagcgacacactgcgatgc
ctggccctggccactcatgacaacccactgagaagagaagaaatgcaccttgaggactct
gccaactttattaaatatgagaccaatctgaccttcgttggctgcgtgggcatgctggat
cctccgagaatcgaggtggcctcctccgtgaagctgtgccggcaagcaggcatccgggtc
atcatgatcactggggacaacaagggcactgctgtggccatctgtcgccgcatcggcatc
ttcgggcaggatgaggacgtgacgtcaaaagctttcacaggccgggagtttgatgaactc
aacccctccgcccagcgagacgcctgcctgaacgcccgctgttttgctcgagttgaaccc
tcccacaagtctaaaatcgtagaatttcttcagtcttttgatgagattacagctatgact
ggcgatggcgtgaacgatgctcctgctctgaagaaagccgagattggcattgctatgggc
tctggcactgcggtggctaaaaccgcctctgagatggtcctggcggatgacaacttctcc
accattgtggctgccgttgaggaggggcgggcaatctacaacaacatgaaacagttcatc
cgctacctcatctcgtccaacgtcggggaagttgtctgtattttcctgacagcagccctt
ggatttcccgaggctttgattcctgttcagctgctctgggtcaatctggtgacagatggc
ctgcctgccactgcactggggttcaaccctcctgatctggacatcatgaataaacctccc
cggaacccaaaggaaccattgatcagcgggtggctctttttccgttacttggctattggc
tgttacgtcggcgctgctaccgtgggtgctgctgcatggtggttcattgctgctgacggt
ggtccaagagtgtccttctaccagctgagtcatttcctacagtgtaaagaggacaacccg
gactttgaaggcgtggattgtgcaatctttgaatccccatacccgatgacaatggcgctc
tctgttctagtaactatagaaatgtgtaacgccctcaacagcttgtccgaaaaccagtcc
ttgctgaggatgcccccctgggagaacatctggctcgtgggctccatctgcctgtccatg
tcactccacttcctgatcctctatgtcgaacccttgccactcatcttccagatcacaccg
ctgaacgtgacccagtggctgatggtgctgaaaatctccttgcccgtgattctcatggat
gagacgctcaagtttgtggcccgcaactacctggaacctggtaaagagtgtgtgcagcct
gccaccaaatcctgctcgttctcggcatgcaccgatgggatttcctggccgtttgtgctg
ctcataatgcccctggtgatctgggtctatagcacagacactaactttagcgatatgttc
tggtcttga

DBGET integrated database retrieval system