KEGG   Homo sapiens (human): 493Help
Entry
493               CDS       T01001                                 

Gene name
ATP2B4, ATP2B2, MXRA1, PMCA4, PMCA4b, PMCA4x
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 4
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04925  Aldosterone synthesis and secretion
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    493 (ATP2B4)
   04024 cAMP signaling pathway
    493 (ATP2B4)
   04022 cGMP-PKG signaling pathway
    493 (ATP2B4)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    493 (ATP2B4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    493 (ATP2B4)
  09154 Digestive system
   04970 Salivary secretion
    493 (ATP2B4)
   04972 Pancreatic secretion
    493 (ATP2B4)
   04978 Mineral absorption
    493 (ATP2B4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    493 (ATP2B4)
Enzymes [BR:hsa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     493 (ATP2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 493
NCBI-ProteinID: NP_001675
OMIM: 108732
HGNC: 817
Ensembl: ENSG00000058668
Vega: OTTHUMG00000035906
Pharos: P23634(Tbio)
UniProt: P23634 A0A024R968
Structure
PDB: 

Position
1q32.1
AA seq 1205 aa AA seqDB search
MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKT
SPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGL
QCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKK
GKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLA
VQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVA
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA
YIGGIHYRQIPSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALL
GFVTDLKQDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVIRNPNGGFRMYSKGASEIILRK
CNRILDRKGEAVPFKNKDRDDMVRTVIEPMACDGLRTICIAYRDFDDTEPSWDNENEILT
ELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNINTARAIATKCGILTPGDDFL
CLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGEHRQVV
AVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLL
KRRPYGRNKPLISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGRKAPLHSPPSQHY
TIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFS
CTSLSLSQWLWCLFIGIGELLWGQFISAIPTRSLKFLKEAGHGTTKEEITKDAEGLDEID
HAEMELRRGQILWFRGLNRIQTQIKVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEE
ELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQS
LETSV
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacccatcagaccgtgtcttgcctgccaactcgatggccgagagccgtgaaggg
gactttggctgcacagtaatggaactgaggaagctcatggagctgcgttcaagggatgca
ctgacccagattaatgtccactatggaggtgtacagaatctctgcagtagactgaaaacc
tcccctgtggaaggtctgtctgggaaccctgcagatctggagaaacgtaggcaggtgttt
ggacacaacgtgatcccccccaaaaagcccaagactttcttagaattagtgtgggaagct
cttcaagatgtcacgcttatcatcctggagattgcagccatcatctccctggtcctgtcc
ttttatcgccctgctggtgaagaaaatgaactgtgtggtcaagtcgcaactaccccagaa
gatgaaaatgaggcacaagctggctggattgagggggcagccatccttttctcagtgatc
atcgtggtgttagtgactgcctttaatgattggagcaaagagaagcaattccgggggctg
cagtgccgcattgaacaggagcaaaagttctccatcatccgaaacggtcaactcatccag
ctccctgtggctgagattgtggttggtgatattgcccaagtcaaatacggtgatctgctg
cctgcagatggaatcctgatccaagggaatgatctgaagattgatgagagctctctgaca
ggggaatctgaccatgtcaagaagtccctggacaaagaccccatgttgctctcagggacc
catgtcatggaaggttctggccggatggtggtgacagctgttggtgtcaactctcagact
ggaatcatccttactctcttgggggtcaatgaggatgacgaaggggagaaaaagaagaaa
ggtaaaaaacaaggagtccctgaaaatcgcaacaaagcaaagacccaagacggagtggcc
ctggaaatccagccactcaacagccaggagggaatcgacaatgaggaaaaggacaagaag
gcagtcaaggtgcctaaaaaggagaagtcagtgctgcagggcaagctgactcgcctggct
gttcagattgggaaagccggtctgctcatgtctgctctcacggttttcatcctgattcta
tactttgtgattgacaactttgtgataaatcgcagaccatggctccctgagtgtactccc
atctacatccagtactttgtcaagttcttcatcatcggcatcactgtactggtggtggct
gtgccagaggggctgcctctggctgtcaccatctcactggcctactctgtgaagaaaatg
atgaaagacaataacctagtacggcacttggatgcttgtgagaccatgggcaacgccacc
gccatctgctctgataagacaggcacgttgaccatgaaccgcatgactgtggtacaagct
tatattgggggcatccattaccgtcaaatcccaagccctgatgtcttcctgcccaaagtc
ctggacctcattgtcaatggcatttctatcaacagtgcttatacctccaagattctgcct
ccagagaaggagggaggcctgcctcggcaggtgggcaacaagaccgagtgtgctctgcta
ggctttgtcacagatctgaagcaggattatcaggctgtgcgtaatgaagtgcccgaggag
aagctctacaaggtgtacacctttaactcagtgcgcaagtcaatgagcaccgtcatcagg
aatcccaacggtggcttccgtatgtacagcaagggcgcctctgagatcatcttgcgcaag
tgtaatcgaatcctggaccggaaaggggaagcagtgccattcaagaataaagacagagat
gatatggtacgcactgtcatcgagcccatggcctgtgatggactccggactatctgcata
gcttaccgggacttcgatgacacagagccctcttgggacaatgagaatgagatcctcacc
gaactgacctgtatcgcggtggtgggcattgaggaccctgtgcgcccagaggtgccagat
gctattgccaaatgcaaacaagctggcattactgtcagaatggtgacaggtgacaacatc
aacacagcccgggccattgccaccaaatgtggcattctgacacctggggatgacttcctg
tgcttagaaggcaaagaattcaaccggctcatccgcaacgagaaaggcgaggtagagcaa
gaaaagctggacaagatctggcctaagcttcgggtcctggcgcgatcttctcccactgac
aagcacaccctggtgaaaggcataattgacagcactgttggggaacaccggcaggtcgtg
gctgtcactggtgatggcacaaatgacgggcctgctctgaagaaagcggatgttggtttt
gccatgggcatcgcaggcacagatgtagcaaaggaggcttcagacatcatcctaacagat
gacaacttcaccagcattgtgaaggcagtgatgtggggacgaaatgtctatgacagcatc
tccaagttcctgcagttccagctcactgtcaatgtggtggccgtgattgtagccttcact
ggagcctgtatcactcaggattccccattgaaagctgtgcagatgttgtgggttaatctg
atcatggacacttttgcttcattggccctggccacagagccccctacggaatctctgttg
aagcggcgcccctatggccgaaataagcctctgatctcacgcactatgatgaagaacatc
ttgggccatgcattctatcagctcattgtcatctttatccttgtctttgcgggtgagaaa
ttctttgatattgatagtgggaggaaggcacctctacattcaccacccagccagcactat
accattgtttttaacaccttcgtgctgatgcagctcttcaatgaaatcaactcccgaaag
atccatggagagaagaacgtcttttcaggcatctaccgcaacattatcttctgctctgta
gtcttgggcacattcatctgccagattttcatcgtggaatttgggggtaaacccttcagt
tgtacaagcctcagcctgtctcagtggctgtggtgtctcttcattgggattggagaactt
ctgtggggccagttcatctccgcaatacctacccgatccctgaagttcctgaaggaggct
gggcatggcaccaccaaagaggagatcaccaaggatgccgagggactggatgagattgac
catgctgagatggagctgcgccgaggccagatcctctggttccggggcctgaaccgtatc
cagactcagatcaaagtggtcaaagcgttccatagttccctccacgaaagcattcagaaa
ccctacaaccaaaagtccatccacagcttcatgacccaccctgaattcgccatagaggag
gagttgccacgaacaccactcctggatgaggaagaggaggaaaatcctgacaaggcttct
aagtttgggactagggtgctcctgttggatggtgaggtcactccatatgccaatacaaac
aacaatgcggtggattgcaaccaagtgcagctcccccagtcggacagctctctacagagc
ctagagacatcagtttga

DBGET integrated database retrieval system