KEGG   Homo sapiens (human): 495
Entry
495               CDS       T01001                                 

Gene name
ATP4A, ATP6A
Definition
(RefSeq) ATPase H+/K+ transporting subunit alpha
  KO
K01542  H+/K+-exchanging ATPase subunit alpha [EC:7.2.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04966  Collecting duct acid secretion
hsa04971  Gastric acid secretion
Drug target
Dexlansoprazole: D08903<US>
Esomeprazole (DG00023): D01984<JP/US> D04056<US> D07917 D09339 D10120<US> D11114<US>
Lansoprazole: D00355<JP/US>
Leminoprazole: D05906
Omeprazole (DG00020): D00455<JP/US> D01207 D05259<US> D05261<JP>
Pantoprazole (DG00021): D02593<US> D05353
Penaprazole sodium hydrate: D09837
Picoprazole: D05901
Rabeprazole (DG00022): D00724<JP/US> D08463
Revaprazan hydrochloride: D05722
Tenatoprazole: D01920
Timoprazole: D05900
Vonoprazan (DG03104): D10466<JP> D11784
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    495 (ATP4A)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    495 (ATP4A)
  09155 Excretory system
   04966 Collecting duct acid secretion
    495 (ATP4A)
Enzymes [BR:hsa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.19  H+/K+-exchanging ATPase
     495 (ATP4A)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase H-K_ATPase_N Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 495
NCBI-ProteinID: NP_000695
OMIM: 137216
HGNC: 819
Ensembl: ENSG00000105675
Vega: OTTHUMG00000048106
Pharos: P20648(Tclin)
UniProt: P20648 Q658V6 A0A384MR29
Position
19q13.12
AA seq 1035 aa
MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVA
ELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAA
ICLIAFAIQASEGDLTTDDNLYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQA
TVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSP
ECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIE
HFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAK
RLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMG
YRDRFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELP
LDEQWREAFQTAYLSLGGLGERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLV
SMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLR
VPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLG
AIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIF
DNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQ
WEDHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGF
FRNKILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLG
VRCCPGSWWDQELYY
NT seq 3108 nt   +upstreamnt  +downstreamnt
atggggaaggccgagaactatgagctctactcggtggagctgggtcctggccctggcggg
gacatggctgccaagatgagcaagaagaagaaggcgggtggcgggggtggcaagaggaag
gagaagctggagaacatgaagaaggagatggagattaacgaccaccagctgtcagtggcg
gagctggaacagaaataccagaccagtgccaccaagggcctctctgcgagcctggctgct
gagctgctgctgcgggatgggcccaacgcactgcggccaccacggggcaccccagagtac
gtcaagttcgcgaggcagctggccgggggcctgcagtgcctcatgtgggttgccgccgcc
atctgcctcatcgcctttgccatccaggctagtgagggggacctcaccaccgacgacaat
ctgtacctggcaatcgctctcattgctgtggttgtcgtcaccggctgctttggctactac
caggaattcaagagcaccaacatcatcgccagctttaagaaccttgtgccacagcaagcc
actgtcatccgcgatggagacaaattccagatcaacgctgaccaactggtggtgggcgac
ctggtggagatgaaaggtggggacagagtgcccgccgacatccgcatcctggcggcccag
ggctgcaaggtggacaactcctcgctgacaggggagtctgagccacagacccgctcaccc
gagtgcacgcacgagagccctctggagacccgcaacatcgccttcttctccaccatgtgc
cttgagggcaccgtgcagggcctggtggtgaacacgggcgaccgcaccatcattgggcgc
atcgcatcgctggcgtcgggggtggaaaacgagaagacacccatcgctatcgagatcgag
cattttgtggacatcatcgcgggcctggccattctcttcggtgccacattttttattgtg
gccatgtgcattggctacaccttcctgcgggccatggtcttcttcatggccatcgtggtg
gcctatgtgcctgaggggctgctggccactgtcacagtctgcctgtccctgacagccaag
cgcctggccagtaagaactgcgtggtcaagaacctggaggcggtggagacattgggctcc
acttcggtgatctgctcggacaagacagggactctcactcagaaccgcatgactgtgtcc
catctgtggtttgacaaccacatccacacagctgacaccacggaagaccagtcagggcag
acgtttgaccagtcctcggagacgtggcgggcgctgtgccgggtgctcaccctgtgcaac
cgcgccgccttcaagtccggccaggatgcagtgcctgtgcccaagcgcatcgtgattgga
gacgcatcggagacggcgctgctcaagttctcggagctgacgctgggcaacgccatgggc
taccgggaccgcttcccaaaagtctgcgagatacccttcaactccaccaacaagttccag
ctgtccatccatacgctggaggacccgcgggacccgcgacacttgctggtgatgaagggc
gcccccgagcgcgtgctggagcgctgcagctccatccttatcaagggccaggagctgccg
ctggacgagcagtggcgcgaggccttccagaccgcctacctcagcctgggaggcctgggc
gaacgcgtgctcggcttctgccagctctacctgaatgagaaggactacccgcctggctat
gccttcgacgtagaggccatgaactttccatctagcggcctctgctttgcgggacttgta
tccatgattgacccaccccgggccaccgtccctgatgctgtgctcaagtgtcgcaccgca
ggcatccgggtgatcatggtaacgggtgaccaccccatcaccgccaaggccattgcagcc
agtgtgggcatcatctcggaaggcagcgagacagtggaggacatcgctgcccgcctccgt
gtgcccgtagaccaggttaatcgcaaggatgcccgtgcctgtgtgatcaatggcatgcag
ctgaaggacatggacccatcggaactggtcgaggccctgcgcacccaccccgagatggtg
tttgcgcgcaccagcccccagcagaagctggtgatcgtggagagctgccagcggctgggt
gcgattgtggccgtcacgggggatggtgtgaatgactccccagctctgaagaaggcagac
atcggagtagccatgggcatcgctggctcagatgctgccaaaaatgcagctgacatgatc
ctgctggatgacaactttgcctccattgtgacaggcgtggagcagggtcgactgatcttc
gacaacctgaagaagtctattgcctacacattgaccaagaacatcccagagctgacaccc
tacctcatctacatcaccgtcagcgtgcccctgcccctcgggtgcatcaccatcctcttc
atcgaactctgcactgacattttcccatctgtgtccctggcatatgaaaaggccgagagt
gacatcatgcacctgcgtccacgcaacccaaagcgtgacagattggtcaacgagcccctg
gctgcctactcctacttccagattggtgccattcagtcctttgctggcttcactgactac
ttcacggcaatggcccaggagggctggttcccactgctgtgcgtggggctgcgggcgcag
tgggaggaccaccacctacaagatctgcaggacagctacggccaggagtggacattcggg
cagcgcctgtaccagcagtacacctgctacaccgtgttcttcatcagcattgaggtgtgc
cagatcgccgatgtcctcatccgcaagacgcgccgtctctctgccttccagcaaggcttc
ttcaggaataagatcctggtgatcgccatcgtgttccaggtctgcatcggctgcttcctg
tgctactgccccggcatgcccaacatcttcaacttcatgcccattcggttccagtggtgg
ctggtccccctgccctacggcatcctcatcttcgtctatgatgagatccggaagcttgga
gttcgctgttgcccagggagctggtgggaccaggaactctactattag

DBGET integrated database retrieval system