KEGG   Homo sapiens (human): 495Help
Entry
495               CDS       T01001                                 

Gene name
ATP4A, ATP6A
Definition
(RefSeq) ATPase H+/K+ transporting subunit alpha
  KO
K01542  H+/K+-exchanging ATPase alpha polypeptide [EC:3.6.3.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa04966  Collecting duct acid secretion
hsa04971  Gastric acid secretion
Drug target
Dexlansoprazole: D08903
Esomeprazole (DG00023): D01984 D04056 D07917 D09339 D10120
Lansoprazole: D00355
Leminoprazole: D05906
Omeprazole (DG00020): D00455 D01207 D05259 D05261
Pantoprazole (DG00021): D02593 D05353
Penaprazole sodium hydrate: D09837
Picoprazole: D05901
Rabeprazole (DG00022): D00724 D08463
Tenatoprazole: D01920
Timoprazole: D05900
Vonoprazan fumarate: D10466
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    495 (ATP4A)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    495 (ATP4A)
  Excretory system
   04966 Collecting duct acid secretion
    495 (ATP4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.10  H+/K+-exchanging ATPase
     495 (ATP4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase H-K_ATPase_N Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Motif
Other DBs
NCBI-GeneID: 495
NCBI-ProteinID: NP_000695
OMIM: 137216
HGNC: 819
Ensembl: ENSG00000105675
Vega: OTTHUMG00000048106
Pharos: P20648(Tclin)
UniProt: P20648 Q658V6
Position
19q13.12
AA seq 1035 aa AA seqDB search
MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVA
ELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAA
ICLIAFAIQASEGDLTTDDNLYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQA
TVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSP
ECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIE
HFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAK
RLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMG
YRDRFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELP
LDEQWREAFQTAYLSLGGLGERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLV
SMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLR
VPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLG
AIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIF
DNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQ
WEDHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGF
FRNKILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLG
VRCCPGSWWDQELYY
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggccgagaactatgagctctactcggtggagctgggtcctggccctggcggg
gacatggctgccaagatgagcaagaagaagaaggcgggtggcgggggtggcaagaggaag
gagaagctggagaacatgaagaaggagatggagattaacgaccaccagctgtcagtggcg
gagctggaacagaaataccagaccagtgccaccaagggcctctctgcgagcctggctgct
gagctgctgctgcgggatgggcccaacgcactgcggccaccacggggcaccccagagtac
gtcaagttcgcgaggcagctggccgggggcctgcagtgcctcatgtgggttgccgccgcc
atctgcctcatcgcctttgccatccaggctagtgagggggacctcaccaccgacgacaat
ctgtacctggcaatcgctctcattgctgtggttgtcgtcaccggctgctttggctactac
caggaattcaagagcaccaacatcatcgccagctttaagaaccttgtgccacagcaagcc
actgtcatccgcgatggagacaaattccagatcaacgctgaccaactggtggtgggcgac
ctggtggagatgaaaggtggggacagagtgcccgccgacatccgcatcctggcggcccag
ggctgcaaggtggacaactcctcgctgacaggggagtctgagccacagacccgctcaccc
gagtgcacgcacgagagccctctggagacccgcaacatcgccttcttctccaccatgtgc
cttgagggcaccgtgcagggcctggtggtgaacacgggcgaccgcaccatcattgggcgc
atcgcatcgctggcgtcgggggtggaaaacgagaagacacccatcgctatcgagatcgag
cattttgtggacatcatcgcgggcctggccattctcttcggtgccacattttttattgtg
gccatgtgcattggctacaccttcctgcgggccatggtcttcttcatggccatcgtggtg
gcctatgtgcctgaggggctgctggccactgtcacagtctgcctgtccctgacagccaag
cgcctggccagtaagaactgcgtggtcaagaacctggaggcggtggagacattgggctcc
acttcggtgatctgctcggacaagacagggactctcactcagaaccgcatgactgtgtcc
catctgtggtttgacaaccacatccacacagctgacaccacggaagaccagtcagggcag
acgtttgaccagtcctcggagacgtggcgggcgctgtgccgggtgctcaccctgtgcaac
cgcgccgccttcaagtccggccaggatgcagtgcctgtgcccaagcgcatcgtgattgga
gacgcatcggagacggcgctgctcaagttctcggagctgacgctgggcaacgccatgggc
taccgggaccgcttcccaaaagtctgcgagatacccttcaactccaccaacaagttccag
ctgtccatccatacgctggaggacccgcgggacccgcgacacttgctggtgatgaagggc
gcccccgagcgcgtgctggagcgctgcagctccatccttatcaagggccaggagctgccg
ctggacgagcagtggcgcgaggccttccagaccgcctacctcagcctgggaggcctgggc
gaacgcgtgctcggcttctgccagctctacctgaatgagaaggactacccgcctggctat
gccttcgacgtagaggccatgaactttccatctagcggcctctgctttgcgggacttgta
tccatgattgacccaccccgggccaccgtccctgatgctgtgctcaagtgtcgcaccgca
ggcatccgggtgatcatggtaacgggtgaccaccccatcaccgccaaggccattgcagcc
agtgtgggcatcatctcggaaggcagcgagacagtggaggacatcgctgcccgcctccgt
gtgcccgtagaccaggttaatcgcaaggatgcccgtgcctgtgtgatcaatggcatgcag
ctgaaggacatggacccatcggaactggtcgaggccctgcgcacccaccccgagatggtg
tttgcgcgcaccagcccccagcagaagctggtgatcgtggagagctgccagcggctgggt
gcgattgtggccgtcacgggggatggtgtgaatgactccccagctctgaagaaggcagac
atcggagtagccatgggcatcgctggctcagatgctgccaaaaatgcagctgacatgatc
ctgctggatgacaactttgcctccattgtgacaggcgtggagcagggtcgactgatcttc
gacaacctgaagaagtctattgcctacacattgaccaagaacatcccagagctgacaccc
tacctcatctacatcaccgtcagcgtgcccctgcccctcgggtgcatcaccatcctcttc
atcgaactctgcactgacattttcccatctgtgtccctggcatatgaaaaggccgagagt
gacatcatgcacctgcgtccacgcaacccaaagcgtgacagattggtcaacgagcccctg
gctgcctactcctacttccagattggtgccattcagtcctttgctggcttcactgactac
ttcacggcaatggcccaggagggctggttcccactgctgtgcgtggggctgcgggcgcag
tgggaggaccaccacctacaagatctgcaggacagctacggccaggagtggacattcggg
cagcgcctgtaccagcagtacacctgctacaccgtgttcttcatcagcattgaggtgtgc
cagatcgccgatgtcctcatccgcaagacgcgccgtctctctgccttccagcaaggcttc
ttcaggaataagatcctggtgatcgccatcgtgttccaggtctgcatcggctgcttcctg
tgctactgccccggcatgcccaacatcttcaacttcatgcccattcggttccagtggtgg
ctggtccccctgccctacggcatcctcatcttcgtctatgatgagatccggaagcttgga
gttcgctgttgcccagggagctggtgggaccaggaactctactattag

DBGET integrated database retrieval system