KEGG   Homo sapiens (human): 4968
Entry
4968              CDS       T01001                                 
Symbol
OGG1, HMMH, HOGG1, MUTM, OGH1
Name
(RefSeq) 8-oxoguanine DNA glycosylase
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Network
nt06504  Base excision repair
  Element
N01434  Base excision and strand cleavage by bifunctional glycosylase
Disease
H00021  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4968 (OGG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4968 (OGG1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     4968 (OGG1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4968 (OGG1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4968 (OGG1)
SSDB
Motif
Pfam: OGG_N HhH-GPD HHH
Other DBs
NCBI-GeneID: 4968
NCBI-ProteinID: NP_002533
OMIM: 601982
HGNC: 8125
Ensembl: ENSG00000114026
Pharos: O15527(Tbio)
UniProt: O15527 E5KPN1
Structure
Position
3:9749952..9783108
AA seq 345 aa
MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
CILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgcctgcccgcgcgcttctgcccaggcgcatggggcatcgtactctagcctccactcct
gccctgtgggcctccatcccgtgccctcgctctgagctgcgcctggacctggttctgcct
tctggacaatctttccggtggagggagcaaagtcctgcacactggagtggtgtactagcg
gatcaagtatggacactgactcagactgaggagcagctccactgcactgtgtaccgagga
gacaagagccaggctagcaggcccacaccagacgagctggaggccgtgcgcaagtacttc
cagctagatgttaccctggctcaactgtatcaccactggggttccgtggactcccacttc
caagaggtggctcagaaattccaaggtgtgcgactgctgcgacaagaccccatcgaatgc
cttttctcttttatctgttcctccaacaacaacatcgcccgcatcactggcatggtggag
cggctgtgccaggcttttggacctcggctcatccagcttgatgatgtcacctaccatggc
ttccccagcctgcaggccctggctgggccagaggtggaggctcatctcaggaagctgggc
ctgggctatcgtgcccgttacgtgagtgccagtgcccgagccatcctggaagaacagggc
gggctagcctggctgcagcagctacgagagtcctcatatgaggaggcccacaaggccctc
tgcatcctgcctggagtgggcaccaaggtggctgactgcatctgcctgatggccctagac
aagccccaggctgtgcccgtggatgtccatatgtggcacattgcccaacgtgactacagc
tggcaccctaccacgtcccaggcgaagggaccgagcccccagaccaacaaggaactggga
aactttttccggagcctgtggggaccttatgctggctgggcccaagcggtgctgttcagt
gccgacctgcgccaatcccgccatgctcaggagccaccagcaaagcgcagaaagggttcc
aaagggccggaaggctag

DBGET integrated database retrieval system