KEGG   Homo sapiens (human): 4968Help
Entry
4968              CDS       T01001                                 

Gene name
OGG1, HMMH, HOGG1, MUTM, OGH1
Definition
(RefSeq) 8-oxoguanine DNA glycosylase
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4968 (OGG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4968 (OGG1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     4968 (OGG1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4968 (OGG1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4968 (OGG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OGG_N HhH-GPD HHH
Motif
Other DBs
NCBI-GeneID: 4968
NCBI-ProteinID: NP_002533
OMIM: 601982
HGNC: 8125
Ensembl: ENSG00000114026
Vega: OTTHUMG00000097091
Pharos: O15527(Tbio)
UniProt: O15527 E5KPN1
Structure
PDB: 

Position
3p25.3
AA seq 345 aa AA seqDB search
MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
CILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccgcgcgcttctgcccaggcgcatggggcatcgtactctagcctccactcct
gccctgtgggcctccatcccgtgccctcgctctgagctgcgcctggacctggttctgcct
tctggacaatctttccggtggagggagcaaagtcctgcacactggagtggtgtactagcg
gatcaagtatggacactgactcagactgaggagcagctccactgcactgtgtaccgagga
gacaagagccaggctagcaggcccacaccagacgagctggaggccgtgcgcaagtacttc
cagctagatgttaccctggctcaactgtatcaccactggggttccgtggactcccacttc
caagaggtggctcagaaattccaaggtgtgcgactgctgcgacaagaccccatcgaatgc
cttttctcttttatctgttcctccaacaacaacatcgcccgcatcactggcatggtggag
cggctgtgccaggcttttggacctcggctcatccagcttgatgatgtcacctaccatggc
ttccccagcctgcaggccctggctgggccagaggtggaggctcatctcaggaagctgggc
ctgggctatcgtgcccgttacgtgagtgccagtgcccgagccatcctggaagaacagggc
gggctagcctggctgcagcagctacgagagtcctcatatgaggaggcccacaaggccctc
tgcatcctgcctggagtgggcaccaaggtggctgactgcatctgcctgatggccctagac
aagccccaggctgtgcccgtggatgtccatatgtggcacattgcccaacgtgactacagc
tggcaccctaccacgtcccaggcgaagggaccgagcccccagaccaacaaggaactggga
aactttttccggagcctgtggggaccttatgctggctgggcccaagcggtgctgttcagt
gccgacctgcgccaatcccgccatgctcaggagccaccagcaaagcgcagaaagggttcc
aaagggccggaaggctag

DBGET integrated database retrieval system