KEGG   Homo sapiens (human): 5000Help
Entry
5000              CDS       T01001                                 

Gene name
ORC4, ORC4L, ORC4P
Definition
(RefSeq) origin recognition complex subunit 4
  KO
K02606  origin recognition complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Module
hsa_M00284  Origin recognition complex
Disease
H00464  Patella dysplasias
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5000 (ORC4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    5000 (ORC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC4_C AAA_16 AAA AAA_22 ATPase_2 NACHT AAA_19 TniB AAA_14 DUF815 NB-ARC DUF2075 DAP3 T2SSE KAP_NTPase Mg_chelatase AAA_33 AAA_18 ABC_tran AAA_5 RsgA_GTPase cobW SRPRB AAA_30 AAA_24 AAA_29
Motif
Other DBs
NCBI-GeneID: 5000
NCBI-ProteinID: NP_001177808
OMIM: 603056
HGNC: 8490
Ensembl: ENSG00000115947
Vega: OTTHUMG00000131849
Pharos: O43929(Tbio)
UniProt: O43929
Structure
PDB: 

Position
2q23.1
AA seq 436 aa AA seqDB search
MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGES
NSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNL
ENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDIS
QSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEF
PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAV
DLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRK
AHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN
CPTDVRQWATSSLSWL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcgtaaatcaaagagtaacagcttaattcacacagagtgcctttcacaggta
caaagaattttacgtgaaagattttgtcgtcagagtccacatagtaacctatttggagtg
caagtacaatacaaacacttaagtgagctgctgaaaagaactgctctccatggagagagt
aactctgtccttattatcggaccccgaggatcaggaaaaactatgttaataaatcatgct
ttgaaagaactcatggaaatagaagaagtgagtgaaaatgtattacaagttcacttaaat
ggactgctgcagatcaatgacaaaatcgccctaaaggaaatcacaaggcagttaaatctg
gaaaatgtagttggagataaagtttttggaagctttgctgaaaacctttcatttcttctg
gaagctttaaaaaaaggtgaccgaactagcagttgcccagtgatcttcatattagatgaa
tttgatctttttgctcatcataaaaaccaaacacttctctataatctttttgacatttct
cagtctgcacagaccccaatagcagttattggtcttacatgtagattggatattttggaa
ctcttagaaaaaagagtgaagtcaagattttctcaccggcagatacacttaatgaattca
tttggttttccacagtatgttaaaatatttaaagaacagttatctctacctgcagagttt
ccagacaaggtttttgctgagaagtggaatgaaaatgttcagtatctctcagaagataga
agtgtgcaagaagtactacagaagcatttcaatatcagcaaaaacctgcggtcattacac
atgctattgatgcttgctttaaatcgagtaacagcatcgcacccatttatgactgccgta
gatctaatggaagcaagccaactgtgtagcatggactcgaaagcaaatattgtacatggt
ctatcagtcttggaaatctgtcttataatagcaatgaaacatttaaatgacatctatgag
gaagagccatttaattttcaaatggtctataatgagtttcagaagtttgttcaaaggaaa
gcacattccgtttataattttgaaaaacctgttgtcatgaaggcttttgaacacttgcag
caattagaattaataaagcccatggaaagaacttcaggaaattcacagagagagtaccag
ctgatgaaactgcttttggataatactcaaattatgaatgctctgcagaaatatcccaac
tgtcctacagatgtgaggcagtgggcaacatcctcactaagctggttatga

DBGET integrated database retrieval system