KEGG   Homo sapiens (human): 5089
Entry
5089              CDS       T01001                                 
Symbol
PBX2, G17, HOX12, PBX2MHC
Name
(RefSeq) PBX homeobox 2
  KO
K15609  pre-B-cell leukemia transcription factor 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5089 (PBX2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain TALE
    5089 (PBX2)
SSDB
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin HTH_3
Other DBs
NCBI-GeneID: 5089
NCBI-ProteinID: NP_002577
OMIM: 176311
HGNC: 8633
Ensembl: ENSG00000204304
Vega: OTTHUMG00000031116
Pharos: P40425(Tbio)
UniProt: P40425 A0A024RCR3
Position
6:complement(32184733..32190202)
AA seq 430 aa
MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDIGDILQQI
MTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRSSQEEEPVDPQLMRLDN
MLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYE
QACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSR
FLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRI
RYKKNIGKFQEEANIYAVKTAVSVTQGGHSRTSSPTPPSSAGSGGSFNLSGSGDMFLGMP
GLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEG
PGSVHSDTSN
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggacgaacggctactggggccgccccctccaggcgggggccgggggggcctgggattg
gtgagtggggagcctgggggccctggcgagcctcccggtggcggagaccccggtgggggt
agcgggggggtcccgggaggccgagggaagcaagacatcggggacattctgcagcagata
atgaccatcaccgaccagagcctggacgaggcccaggccaagaaacacgccctaaactgc
caccgaatgaagcctgctctctttagcgtcctgtgtgaaatcaaggagaaaactggcctc
agcattcggagctcccaggaggaggagccggtggacccacagctgatgcgcttggacaac
atgcttctggcagagggtgtggctgggcccgagaaagggggcggctcagcagcagcagct
gcagccgctgcagcctctggtggtggtgtgtcccctgacaactccatcgaacactcggac
tatcgcagcaaacttgcccagatccgtcacatataccactcggagctggagaagtatgag
caggcatgtaatgagttcacgacccatgtcatgaacctgctgagggagcagagccgcacc
aggcccgtggcccccaaagagatggaacgcatggtgagcatcatccatcgaaagttcagc
gccatccagatgcagctgaagcagagcacctgcgaggctgtgatgatcctgcgctcccgt
ttcctggatgccagacgaaagcgccgtaacttcagcaaacaggccactgaggtcctaaat
gagtatttctactcccacctgagtaacccatatcctagtgaggaggccaaggaggagctt
gccaagaagtgtggcatcaccgtgtctcaggtctccaactggtttggcaacaagaggatt
cgctataagaaaaacatcggaaagttccaagaggaggcaaacatctatgctgtcaagacc
gccgtgtcagtcacccaggggggccacagccgcaccagctccccgacacccccttcctct
gcaggctctggcggctctttcaatctctcaggatctggagacatgtttctggggatgcct
gggctcaacggagattcctattctgcttcccaggtggaatcactccgacactcgatgggg
ccagggggctatggggataacctcgggggaggccagatgtacagcccacgggaaatgagg
gcaaatggcagctggcaagaggctgtgaccccctcttcagtgacatccccaacggaggga
ccagggagtgttcactctgatacctccaactga

DBGET integrated database retrieval system