KEGG   Homo sapiens (human): 51005
Entry
51005             CDS       T01001                                 

Gene name
AMDHD2, CGI-14
Definition
(RefSeq) amidohydrolase domain containing 2
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    51005 (AMDHD2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     51005 (AMDHD2)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-GeneID: 51005
NCBI-ProteinID: NP_001317378
HGNC: 24262
Ensembl: ENSG00000162066
Vega: OTTHUMG00000128866
Pharos: Q9Y303(Tchem)
UniProt: Q9Y303
Position
16p13.3
AA seq 409 aa
MRGEQGAAGARVLQFTNCRILRGGKLLREDLWVRGGRILDPEKLFFEERRVADERRDCGG
RILAPGFIDVQINGGFGVDFSQATEDVGSGVALVARRILSHGVTSFCPTLVTSPPEVYHK
VVPQIPVKSGGPHGAGVLGLHLEGPFISREKRGAHPEAHLRSFEADAFQDLLATYGPLDN
VRIVTLAPELGRSHEVIRALTARGICVSLGHSVADLRAAEDAVWSGATFITHLFNAMLPF
HHRDPGIVGLLTSDRLPAGRCIFYGMIADGTHTNPAALRIAHRAHPQGLVLVTDAIPALG
LGNGRHTLGQQEVEVDGLTAYVAGTKTLSGSIAPMDVCVRHFLQATGCSMESALEAASLH
PAQLLGLEKSKGTLDFGADADFVVLDDSLHVQATYISGELVWQADAARQ
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcgcggcgagcagggcgcggcgggggcccgcgtgctccagttcactaactgccggatc
ctgcgcggagggaaactgctcagggaggatctgtgggtgcgcggaggccgcatcttggac
ccagagaagctgttctttgaggagcggcgcgtggccgacgagcggcgggactgcgggggc
cgcatcttggctcccggattcatcgacgtgcagatcaacggtggatttggtgttgacttc
tctcaagccacggaggacgtgggttcgggggttgccctcgtggcccggaggatcctgtcg
cacggcgtcacctccttctgccccaccctggtcacttccccaccggaggtttatcacaag
gttgttcctcagatccctgtgaagagtggtggtccccatggggcaggggtcctcgggctg
cacctggagggccccttcatcagccgggagaagcggggcgcgcaccccgaggcccacctc
cgctccttcgaggccgatgccttccaggacttgctggccacctacgggcccctggacaat
gtccgcatcgtgacgctggccccagagttgggccgtagccacgaagtgatccgggcgctg
acggcccgtggcatctgcgtgtccctagggcactcagtggctgacctgcgggcggcagag
gatgctgtgtggagcggagccaccttcatcacccacctcttcaacgccatgctgcctttc
caccaccgcgacccaggcatcgtggggctcctgaccagcgaccggctgcccgcaggccgc
tgcatcttctatgggatgattgcagatggcacgcacaccaaccccgccgccctgcggatc
gcccaccgtgcccatccccaggggctggtgctggtcaccgatgccatccctgccttgggc
ctgggcaacggccggcacacgctgggacagcaggaagtggaagtggacggtctgacggcc
tacgtggcaggcaccaagacgctgagtggcagcatagccccaatggacgtctgtgtccgg
cacttcctgcaggccacaggctgcagcatggagtcggccctggaggctgcatccctgcac
cccgcccagttgctggggctggagaagagtaaggggaccctggactttggtgctgacgca
gacttcgtggtgctcgacgactcccttcacgtccaggccacctacatctcgggtgagctg
gtgtggcaggcggacgcagctaggcagtga

DBGET integrated database retrieval system