KEGG   Homo sapiens (human): 51100Help
Entry
51100             CDS       T01001                                 

Gene name
SH3GLB1, Bif-1, CGI-61, PPP1R70, dJ612B15.2
Definition
(RefSeq) SH3 domain containing GRB2 like, endophilin B1
  KO
K11248  endophilin-B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    51100 (SH3GLB1)
   04140 Autophagy - animal
    51100 (SH3GLB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     51100 (SH3GLB1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    51100 (SH3GLB1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    51100 (SH3GLB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    51100 (SH3GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_9 BAR_2 BAR_3 SH3_1 SH3_2
Motif
Other DBs
NCBI-GeneID: 51100
NCBI-ProteinID: NP_057093
OMIM: 609287
HGNC: 10833
Ensembl: ENSG00000097033
Vega: OTTHUMG00000010257
Pharos: Q9Y371(Tbio)
UniProt: Q9Y371 A0A140VJU5
Position
1p22.3
AA seq 365 aa AA seqDB search
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSD
LKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITY
LELLN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcatggacttcaacgtgaagaagctggcggccgacgcaggcaccttcctcagt
cgcgccgtgcagttcacagaagaaaagcttggccaggctgagaagacagaattggatgct
cacttagagaacctccttagcaaagctgaatgtaccaaaatatggacagaaaaaataatg
aaacaaactgaagtgttattgcagccaaatccaaatgccaggatagaagaatttgtttat
gagaaactggatagaaaagctccaagtcgtataaacaacccagaacttttgggacaatat
atgattgatgcagggactgagtttggcccaggaacagcttatggtaatgcccttattaaa
tgtggagaaacccaaaaaagaattggaacagcagacagagaactgattcaaacgtcagcc
ttaaattttcttactcctttaagaaactttatagaaggagattacaaaacaattgctaaa
gaaaggaaactattgcaaaataagagactggatttggatgctgcaaaaacgagactaaaa
aaggcaaaagctgcagaaactagaaattcatctgaacaggaattaagaataactcaaagt
gaatttgatcgtcaagcagagattaccagacttctgctagagggaatcagcagtacacat
gcccatcaccttcgctgtctgaatgactttgtagaagcccagatgacttactatgcacag
tgttaccagtatatgttggacctccagaaacaactgggaagttttccatccaattatctt
agtaacaacaatcagacttctgtgacacctgtaccatcagttttaccaaatgcgattggt
tcttctgccatggcttcaacaagtggcctagtaatcacctctccttccaacctcagtgac
cttaaggagtgtagtggcagcagaaaggccagggttctctatgattatgatgcagcaaac
agtactgaattatcacttctggcagatgaggtgatcactgtgttcagtgttgttggaatg
gattcagactggctaatgggggaaaggggaaaccagaagggcaaggtgccaattacctac
ttagaactgctcaattaa

DBGET integrated database retrieval system