KEGG   Homo sapiens (human): 51136Help
Entry
51136             CDS       T01001                                 

Gene name
RNFT1, PTD016
Definition
(RefSeq) ring finger protein, transmembrane 1
  KO
K22379  E3 ubiquitin-protein ligase RNFT1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51136 (RNFT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     51136 (RNFT1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    51136 (RNFT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 zf-RING_2 Prok-RING_4 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX zf-C3HC4 zf-rbx1 zf-C3HC4_4 zf-RING_6 Zn_ribbon_17
Motif
Other DBs
NCBI-GeneID: 51136
NCBI-ProteinID: NP_057209
OMIM: 615172
HGNC: 30206
Ensembl: ENSG00000189050
Vega: OTTHUMG00000148658
Pharos: Q5M7Z0(Tdark)
UniProt: Q5M7Z0
Position
17q23.1
AA seq 435 aa AA seqDB search
MPLFLLSLPTPPSASGHERRQRPEAKTSGSEKKYLRAMQANRSQLHSPPGTGSSEDASTP
QCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSH
SEARLTDDTAAESGDHGSSSFSEFRYLFKWLQKSLPYILILSVKLVMQHITGISLGIGLL
TTFMYANKSIVNQVFLRERSSKIQCAWLLVFLAGSSVLLYYTFHSQSLYYSLIFLNPTLD
HLSFWEVFWIVGITDFILKFFFMGLKCLILLVPSFIMPFKSKGYWYMLLEELCQYYRTFV
PIPVWFRYLISYGEFGNVTRWSLGILLALLYLILKLLEFFGHLRTFRQVLRIFFTQPSYG
VAASKRQCSDVDDICSICQAEFQKPILLICQHIFCEECMTLWFNREKTCPLCRTVISDHI
NKWKDGATSSHLQIY
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgttcttgctgtcgctcccgacacctccgtccgcttctggtcatgagaggaga
cagaggcctgaagcaaagacatctgggtcagagaaaaagtatttaagggccatgcaagcc
aatcgtagccaactgcacagtcctccaggaactggaagcagtgaggatgcctcaacccct
cagtgtgtccacacaagattgacaggagagggttcttgccctcattctggagatgttcat
atccagataaactccatacctaaagaatgtgcagaaaatgcaagctccagaaatataagg
tcaggtgtccatagctgtgcccatggatgtgtacacagtcgcttacggggtcactcccac
agtgaagcaaggctgactgatgatactgccgcagaatctggagatcatggtagtagctcc
ttctcagaattccgctatctcttcaagtggctgcaaaaaagtcttccatatattttgatt
ctgagcgtcaaacttgttatgcagcatataacaggaatttctcttggaattgggctgcta
acaacttttatgtatgcaaacaaaagcattgtaaatcaggtttttctaagagaaaggtcc
tcaaagattcagtgtgcttggttactggtattcttagcaggatcttctgttcttttatat
tacacctttcattctcagtcactttattacagcttaatttttttaaatcctactttggac
catttgagcttctgggaagtattttggattgttggaattacagacttcattctgaaattc
tttttcatgggcttaaaatgccttattttattggtgccttctttcatcatgccttttaaa
tctaagggttactggtatatgcttttagaagaattgtgtcaatactaccgaacttttgtt
cccataccagtttggtttcgctaccttataagctatggggagtttggtaacgtaactaga
tggagtcttgggatactgctggctttactctacctcatattaaaacttttggaatttttt
gggcatctgagaactttcagacaggttttacgaatattttttacacaaccaagttatgga
gtggctgccagcaagagacagtgttcagatgtggatgatatttgttcaatatgtcaagct
gaatttcagaagccaattcttctcatttgtcagcatatattttgtgaagagtgcatgacc
ttatggtttaacagagagaaaacatgtccactctgcagaactgtgatttcagaccatata
aacaaatggaaggatggagccacttcatcacaccttcaaatatattaa

DBGET integrated database retrieval system