KEGG   Homo sapiens (human): 51166Help
Entry
51166             CDS       T01001                                 

Gene name
AADAT, KAT2, KATII, KYAT2
Definition
(RefSeq) aminoadipate aminotransferase
  KO
K00825  kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
hsa01210  2-Oxocarboxylic acid metabolism
Module
hsa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    51166 (AADAT)
   00310 Lysine degradation
    51166 (AADAT)
   00380 Tryptophan metabolism
    51166 (AADAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     51166 (AADAT)
    2.6.1.39  2-aminoadipate transaminase
     51166 (AADAT)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   51166 (AADAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 51166
NCBI-ProteinID: NP_001273612
OMIM: 611754
HGNC: 17929
Ensembl: ENSG00000109576
Vega: OTTHUMG00000160912
Pharos: Q8N5Z0(Tchem)
UniProt: Q8N5Z0 Q4W5N8
Structure
PDB: 

Position
4q33
AA seq 425 aa AA seqDB search
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgcacggttcatcacggcagcgagcgcagccagaaacccttctcccatccgg
accatgactgacatattgagcagaggaccaaaatcgatgatctccttggctggtggctta
ccaaatccaaacatgtttccttttaagactgccgtaatcactgtagaaaatggaaagacc
atccaatttggagaagagatgatgaagagagcacttcagtattctccgagtgctggaatt
ccagagcttttgtcctggctaaaacagttacaaataaaattgcataatcctcctaccatc
cattacccacccagtcaaggacaaatggatctatgtgtcacatctggcagccaacaaggt
ctttgtaaggtgtttgaaatgatcattaatcctggagataatgtcctcctagatgaacct
gcttattcaggaactcttcaaagtctgcacccactgggctgcaacattattaatgttgcc
agtgatgaaagtgggattgttccagattccctaagagacatactttccagatggaaacca
gaagatgcaaagaatccccagaaaaacacccccaaatttctttatactgttccaaatggc
aacaaccctactggaaactcattaaccagtgaacgcaaaaaggaaatctatgagcttgca
agaaaatatgatttcctcataatagaagatgatccttactattttctccagtttaacaag
ttcagggtaccaacatttctttccatggatgttgatggacgtgtcatcagagctgactct
ttttcaaaaatcatttcctctgggttgagaataggatttttaactggtccaaaaccctta
atagagagagttattttacacatacaagtttcaacattgcaccccagcacttttaaccag
ctcatgatatcacagcttctacacgaatggggagaagaaggtttcatggctcatgtagac
agggttattgatttctatagtaaccagaaggatgcaatactggcagctgcagacaagtgg
ttaactggtttggcagaatggcatgttcctgctgctggaatgtttttatggattaaagtt
aaaggcattaatgatgtaaaagaactgattgaagaaaaggccgttaagatgggggtatta
atgctccctggaaatgctttctacgtcgatagctcagctcctagcccttacttgagagca
tccttctcttcagcttctccagaacagatggatgtggccttccaggtattagcacaactt
ataaaagaatctttatga

DBGET integrated database retrieval system