KEGG   Homo sapiens (human): 51201Help
Entry
51201             CDS       T01001                                 

Gene name
ZDHHC2, DHHC2, ZNF372
Definition
(RefSeq) zinc finger DHHC-type containing 2
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51201 (ZDHHC2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     51201 (ZDHHC2)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    51201 (ZDHHC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 51201
NCBI-ProteinID: NP_057437
HGNC: 18469
Ensembl: ENSG00000104219
Vega: OTTHUMG00000163860
Pharos: Q9UIJ5(Tbio)
UniProt: Q9UIJ5 A0A140VKD9
Position
8p22
AA seq 367 aa AA seqDB search
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYH
LLFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTR
TMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSL
LYCLFIAATDLQYFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNK
STLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQ
DPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPGKCKAGMSNPA
LTMENET
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctcgggcccgggcagcagcgccaggcggcggtgccggcgggtgctgtactgg
atcccggtggtgttcatcaccctcctgctcggctggtcctactacgcctacgccatccag
ctgtgcatagtgtccatggaaaacactggcgaacaagttgtgtgcctgatggcctatcat
ctactttttgcaatgtttgtctggtcatactggaaaactatctttacattaccaatgaat
ccttcaaaagaattccatctctcttatgcagagaaagatttgttggagagagagccaaga
ggagaagcccatcaggaagttcttaggcgagcagccaaggatcttcccatctataccagg
accatgtctggagccatccgatactgtgacagatgccaacttataaaaccagatcgctgc
catcactgctccgtctgtgataaatgtattttgaagatggatcatcattgtccatgggtg
aacaattgtgttggattttcaaattataagttctttctccttttcttggcttattctctg
ctctactgcctttttattgcggcaacagatttacagtattttatcaaattttggacaaat
ggcctacctgatactcaagccaagttccatattatgtttttattctttgctgcagctatg
ttttctgtcagcttgtcttctctgtttggctatcattgttggctagtcagcaaaaataaa
tctacattagaggcattcagaagtccagtatttcgacatggaacagataagaatggattc
agcttgggtttcagtaaaaacatgcgacaagtttttggtgatgagaagaagtactggttg
ctacccattttttcaagtctaggtgatggctgctcctttccaacttgccttgttaaccag
gatcctgaacaagcatctactcctgcagggctgaattccacagctaaaaatctcgaaaac
catcagtttcctgcaaagccattgagagagtcccagagccaccttcttactgattctcag
tcttggacggagagcagcataaacccaggaaaatgcaaagctggtatgagcaatcctgca
ttaaccatggaaaatgagacttaa

DBGET integrated database retrieval system