KEGG   Homo sapiens (human): 51276
Entry
51276             CDS       T01001                                 

Gene name
ZNF571, HSPC059
Definition
(RefSeq) zinc finger protein 571
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    51276 (ZNF571)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    51276 (ZNF571)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    51276 (ZNF571)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf_UBZ zf-trcl C1_4 Rpr2 DUF5795
Other DBs
NCBI-GeneID: 51276
NCBI-ProteinID: NP_001277243
HGNC: 25000
Ensembl: ENSG00000180479
Vega: OTTHUMG00000182016
Pharos: Q7Z3V5(Tdark)
UniProt: Q7Z3V5 A0A024R0L0 A8K5U8
Position
19q13.12
AA seq 609 aa
MPHLLVTFRDVAIDFSQEEWECLDPAQRDLYRDVMLENYSNLISLDLESSCVTKKLSPEK
EIYEMESLQWENMGKRINHHLQYNGLGDNMECKGNLEGQEASQEGLYMCVKITCEEKATE
SHSTSSTFHRIIPTKEKLYKCKECRQGFSYLSCLIQHEENHNIEKCSEVKKHRNTFSKKP
SYIQHQRIQTGEKPYECMECGKAFGRTSDLIQHQKIHTNEKPYQCNACGKAFIRGSQLTE
HQRVHTGEKPYECKKCGKAFSYCSQYTLHQRIHSGEKPYECKDCGKAFILGSQLTYHQRI
HSGEKPYECKECGKAFILGSHLTYHQRVHTGEKPYICKECGKAFLCASQLNEHQRIHTGE
KPYECKECGKTFFRGSQLTYHLRVHSGERPYKCKECGKAFISNSNLIQHQRIHTGEKPYK
CKECGKAFICGKQLSEHQRIHTGEKPFECKECGKAFIRVAYLTQHEKIHGEKHYECKECG
KTFVRATQLTYHQRIHTGEKPYKCKECDKAFIYGSQLSEHQRIHRGEKPYECKQCGKAFI
RGSHLTEHLRTHTGEKPYECKECGRAFSRGSELTLHQRIHTGEKPYTCVQCGKDFRCPSQ
LTQHTRLHN
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgccccacttgttggtgactttcagggatgtggccattgacttctctcaggaggaatgg
gaatgcctggaccctgctcagagggacttgtacagggatgtgatgttggagaactacagc
aacctgatctcattggacttggaatccagttgtgtgaccaaaaagttatctccagaaaag
gaaatttatgaaatggaatcactccagtgggagaatatggggaaacgtatcaaccatcac
cttcaatacaatggtcttggagacaatatggagtgcaaaggcaacttagagggtcaagaa
gcaagtcaggaagggctttacatgtgtgtcaaaattacctgtgaagaaaaggccactgaa
agtcattcaacctcttctacttttcatcggataattcctaccaaggaaaaattgtacaaa
tgtaaggaatgcagacaaggtttcagctacctgtcatgccttattcaacatgaggaaaat
cataatatagaaaaatgctctgaagttaagaaacacaggaatacctttagcaaaaagcca
agctatattcaacatcagagaattcagactggtgagaaaccttatgagtgtatggaatgt
ggaaaggcctttggtcgtacttctgatctcattcaacatcagaaaattcatactaatgaa
aaaccttatcagtgtaacgcatgtgggaaagcttttattcgtggttcacagctcactgaa
catcagagagttcatacaggagagaaaccatatgaatgtaagaaatgtggaaaagccttt
agttattgttcacaatatactcttcatcagagaattcatagtggtgaaaaaccctatgaa
tgtaaggattgtgggaaggcctttattcttggctctcaacttacttaccatcagagaatt
catagtggtgagaaaccttatgagtgtaaggaatgtggaaaggcctttattcttggttca
caccttacataccatcagagagttcatactggtgaaaagccttacatatgtaaagaatgt
gggaaagcctttttatgtgcctcccaactgaatgaacatcagagaattcatacaggagag
aaaccctatgaatgtaaagaatgcgggaagaccttttttcgtggctcacaacttacttac
cacctgagagttcattcaggtgagagaccttataaatgcaaagaatgtgggaaagccttt
atttctaattctaatcttattcaacatcaaagaattcataccggagagaagccctacaaa
tgtaaggaatgtggaaaggcctttatttgtggcaaacaacttagtgaacatcagagaatt
catacaggtgagaaaccctttgaatgtaaggaatgtggaaaggcctttattcgtgttgca
tatcttactcaacatgagaaaattcatggtgagaaacattatgaatgtaaggaatgtggg
aagacctttgtacgtgctacacaacttacatatcatcaaagaattcatacaggtgaaaag
ccctacaaatgtaaggaatgtgacaaggcctttatttatggctcacaacttagtgaacat
cagagaattcacagaggtgaaaaaccttatgaatgtaaacagtgtgggaaggcttttatt
cgtggctcacaccttactgaacatctgagaactcatactggagagaaaccctatgaatgt
aaggaatgtgggagggcctttagtcgtggctcagaacttactctgcatcaaaggatccat
actggtgagaaaccctatacatgtgtccagtgtggtaaagactttagatgtccttcacaa
cttactcaacatacaaggcttcataattga

DBGET integrated database retrieval system