KEGG   Homo sapiens (human): 51444Help
Entry
51444             CDS       T01001                                 

Gene name
RNF138, HSD-4, NARF, STRIN, hNARF
Definition
(RefSeq) ring finger protein 138
  KO
K10668  E3 ubiquitin-protein ligase RNF138 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51444 (RNF138)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     51444 (RNF138)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    51444 (RNF138)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_2 zf_C2HC_14 zf-Di19 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_3 zf-Nse zf-C3HC4_4 Prok-RING_4 zf-RING_6 zf-MIZ zf-rbx1 zf-RING_10 zf-RING_4 U-box
Motif
Other DBs
NCBI-GeneID: 51444
NCBI-ProteinID: NP_001178253
OMIM: 616319
HGNC: 17765
Ensembl: ENSG00000134758
Vega: OTTHUMG00000132265
Pharos: Q8WVD3(Tbio)
UniProt: Q8WVD3 A0A140VJT9
Position
18q12.1
AA seq 245 aa AA seqDB search
MAEDLSAATSYTEDDFYCPVCQEVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGN
VTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYRMRHHYKSCKKYQDEYGVSSIIPN
FQISQDSVGNSNRSETSTSDNTETYQENTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNH
LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEETQYQTAVEES
FQVNI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacctctctgcggccacgtcctacaccgaagatgatttctactgccccgtc
tgtcaggaggtgctcaaaacgcccgtgcggaccacggcctgtcagcacgttttctgtaga
aaatgtttcctgactgcaatgagggaaagcggagcacattgtcccctatgtcgtggaaat
gtgactagaagagagagagcatgtcctgaacgggccttagaccttgaaaatataatgagg
aagttttctggtagctgcagatgctgtgcaaaacagattaaattctatcgcatgagacat
cattacaaatcttgtaagaagtatcaggatgaatatggtgtttcttctatcattccaaac
tttcagatctctcaagattcagtagggaacagcaataggagtgaaacatccacatctgat
aacacagaaacttaccaagagaatacaagttcttctggtcatcctacttttaagtgtccc
ctgtgtcaagaatcaaattttaccagacagcgtttactggatcactgtaacagtaatcac
ctatttcagatagttcctgtgacatgtcctatttgtgtgtctcttccttggggagatcct
agccagattaccagaaatttcgttagtcatctaaatcagagacatcaatttgattatgga
gaatttgtgaatcttcagctagatgaagaaacccaataccaaactgctgttgaagaatct
tttcaagtaaacatctga

DBGET integrated database retrieval system