KEGG   Homo sapiens (human): 51517
Entry
51517             CDS       T01001                                 

Gene name
NCKIPSD, AF3P21, DIP, DIP1, ORF1, SPIN90, VIP54, WASLBP, WISH
Definition
(RefSeq) NCK interacting protein with SH3 domain
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF2013 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 51517
NCBI-ProteinID: NP_057537
OMIM: 606671
HGNC: 15486
Ensembl: ENSG00000213672
Vega: OTTHUMG00000133542
Pharos: Q9NZQ3(Tbio)
UniProt: Q9NZQ3
Structure
PDB: 
6DED 6DEE 6DEC

Position
3p21.31
AA seq 722 aa
MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLE
QDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKETLSRRGPSASSVAVMTSS
TSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQPRRAAPT
TPPPPVKRRDREALMASGSGGHNTMPSGGNSVSSGSSVSSTSLDTLYTSSSPSEPGSSCS
PTPPPVPRRGTHTTVSQVQPPPSKASAPEPPAEEEVATGTTSASDDLEALGTLSLGTTEE
KAAAEAAVPRTIGAELMELVRRNTGLSHELCRVAIGIIVGHIQASVPASSPVMEQVLLSL
VEGKDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEGVIRCYLEELLHI
LTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVS
SVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLGTPFAQFLLNIVED
GLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLNRGDDP
VRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEY
LSLMHAIVRTTPYLQHRHRLPDLQAILRRILNEEETSPQCQMDRMIVREMCKEFLVLGEA
PS
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgtaccgcgcgctgtacgcgttccgctcggcggagcccaacgcgctggcgttcgccgcg
ggcgagaccttcctggtgctagagcgaagcagcgcgcactggtggctggccgcgcgggcg
cgcagtggtgagacgggctacgtgccgccagcctacctgcgccgcctgcagggcctggag
caggatgtcctccaggccattgaccgggccatcgaggctgtacacaacacagccatgcgg
gatggtggcaagtacagcctggaacagcgtggagtcctccagaagctgatccaccaccgg
aaagagaccctgtcacgcagaggcccttcagcctccagtgttgcagttatgacctcatca
accagtgaccaccacttggatgctgctgcagccaggcagcccaatggggtgtgtcgagct
gggttcgagcggcagcacagcctacccagttctgagcatcttggggcagatggaggcctc
taccagatcccacttccatcttcccagatcccaccacagcctcgccgagcagcacccacc
acaccgcccccaccagtgaagcgccgagaccgcgaggccctgatggcctctgggagtggt
ggccacaacaccatgccctccgggggtaactctgtgtccagcggctcctcagtcagcagc
acctccctggacacgctctataccagctccagcccatctgaaccaggctccagctgctca
cccacacccccacctgtgccccgccgaggcacccacaccaccgtgtcccaagtccagccc
cctccctccaaggcatcagcacctgaaccccctgcagaagaagaagtggcaactggtaca
acctcagcctctgatgacctggaagccctgggtacactgagcctggggaccacagaggag
aaggcagcagctgaggcggctgtgcccaggaccattggggccgagctgatggagctggtg
cggagaaacactggcctgagccacgaattatgccgggtggccatcggcatcatagtgggt
cacatccaggcctcggtgccggccagctcaccagtcatggagcaggtcctcctctcactc
gtagagggcaaggacctcagcatggccctgccctcagggcaggtctgccacgaccagcag
aggctggaggtgatctttgcagacctggctcgccggaaggacgacgcccagcagcgcagt
tgggcactatatgaggatgagggtgtcatccgctgctacctagaggagctgctgcatatt
ctgactgatgcagaccctgaagtttgcaagaaaatgtgcaagagaaacgagttcgagtct
gtcctggccttggtggcctattaccaaatggaacaccgagcatcactgcggctgctgctc
ctcaagtgctttggcgccatgtgcagcctggatgcagccatcatctccacgcttgtgtca
tccgtgctgcctgtagagctggcgagggacatgcagacagacacgcaggaccaccagaaa
ctctgttactctgccctcatcctggccatggtcttctccatgggagaggcagtgccctat
gcacactatgagcacctgggcacgcctttcgcccagttcctactgaacatcgtcgaggat
gggctgcccttggacaccacagagcagctgccggacctctgcgtgaacctgcttctggct
ctcaacctgcacctgccagctgctgaccagaatgtcatcatggctgccctgagcaaacac
gccaatgtcaagatcttctccgagaagctgttgttgctcctgaacagaggggatgaccct
gtgcgcatcttcaaacatgagccacagccaccacactctgtcctcaagttcctgcaggac
gtgtttggcagcccggccacagctgccatcttctaccacacagacatgatggctctcatt
gacatcactgtgcggcacatcgcagacctgtcaccaggagacaagctgcgcatggagtac
ctctccctgatgcatgctatagtccgcaccacaccctacctgcagcaccgccaccggcta
cccgacctgcaggccatactgcgacgcatcctgaatgaggaggagacctcaccccagtgc
cagatggaccgcatgattgtccgagagatgtgcaaggaattcctggtgctgggggaggct
cccagctag

DBGET integrated database retrieval system